Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	56833
Gene name	SLAM family member 8
Gene symbol	SLAMF8
Synonyms (NCBI Gene)	BLAMECD353SBBI42
Chromosome	1
Chromosome location	1q23.2
Summary	This gene encodes a member of the CD2 family of cell surface proteins involved in lymphocyte activation. These proteins are characterized by Ig domains. This protein is expressed in lymphoid tissues, and studies of a similar protein in mouse suggest that

Show/Hide all (97)

miRTarBase ID	miRNA	Experiments
MIRT1351521	hsa-miR-1183	CLIP-seq
MIRT1351522	hsa-miR-1193	CLIP-seq
MIRT1351523	hsa-miR-1207-5p	CLIP-seq
MIRT1351524	hsa-miR-145	CLIP-seq
MIRT1351525	hsa-miR-146a	CLIP-seq
MIRT1351526	hsa-miR-146b-5p	CLIP-seq
MIRT1351527	hsa-miR-1825	CLIP-seq
MIRT1351528	hsa-miR-199a-5p	CLIP-seq
MIRT1351529	hsa-miR-199b-5p	CLIP-seq
MIRT1351530	hsa-miR-3179	CLIP-seq
MIRT1351531	hsa-miR-3202	CLIP-seq
MIRT1351532	hsa-miR-3612	CLIP-seq
MIRT1351533	hsa-miR-3665	CLIP-seq
MIRT1351534	hsa-miR-3689d	CLIP-seq
MIRT1351535	hsa-miR-3690	CLIP-seq
MIRT1351536	hsa-miR-3691-5p	CLIP-seq
MIRT1351537	hsa-miR-4254	CLIP-seq
MIRT1351538	hsa-miR-4434	CLIP-seq
MIRT1351539	hsa-miR-4443	CLIP-seq
MIRT1351540	hsa-miR-4450	CLIP-seq
MIRT1351541	hsa-miR-4516	CLIP-seq
MIRT1351542	hsa-miR-4531	CLIP-seq
MIRT1351543	hsa-miR-4716-3p	CLIP-seq
MIRT1351544	hsa-miR-4723-5p	CLIP-seq
MIRT1351545	hsa-miR-4736	CLIP-seq
MIRT1351546	hsa-miR-4747-5p	CLIP-seq
MIRT1351547	hsa-miR-4752	CLIP-seq
MIRT1351548	hsa-miR-4763-3p	CLIP-seq
MIRT1351549	hsa-miR-4782-5p	CLIP-seq
MIRT1351550	hsa-miR-491-5p	CLIP-seq
MIRT1351551	hsa-miR-516b	CLIP-seq
MIRT1351552	hsa-miR-650	CLIP-seq
MIRT2104202	hsa-miR-1343	CLIP-seq
MIRT1351524	hsa-miR-145	CLIP-seq
MIRT2104203	hsa-miR-3074-5p	CLIP-seq
MIRT2104204	hsa-miR-3180-5p	CLIP-seq
MIRT2104205	hsa-miR-330-3p	CLIP-seq
MIRT2104206	hsa-miR-371-5p	CLIP-seq
MIRT2104207	hsa-miR-371b-5p	CLIP-seq
MIRT2104208	hsa-miR-412	CLIP-seq
MIRT2104209	hsa-miR-4422	CLIP-seq
MIRT1351544	hsa-miR-4723-5p	CLIP-seq
MIRT2104210	hsa-miR-486-3p	CLIP-seq
MIRT2104211	hsa-miR-584	CLIP-seq
MIRT2104212	hsa-miR-595	CLIP-seq
MIRT2328343	hsa-miR-1182	CLIP-seq
MIRT2328344	hsa-miR-1205	CLIP-seq
MIRT2328345	hsa-miR-1255a	CLIP-seq
MIRT2328346	hsa-miR-1255b	CLIP-seq
MIRT2328347	hsa-miR-1587	CLIP-seq
MIRT2328348	hsa-miR-1909	CLIP-seq
MIRT2328349	hsa-miR-193a-5p	CLIP-seq
MIRT2328350	hsa-miR-2355-3p	CLIP-seq
MIRT2104203	hsa-miR-3074-5p	CLIP-seq
MIRT2328351	hsa-miR-3127-5p	CLIP-seq
MIRT2328352	hsa-miR-3147	CLIP-seq
MIRT2328353	hsa-miR-3151	CLIP-seq
MIRT2328354	hsa-miR-3153	CLIP-seq
MIRT2104206	hsa-miR-371-5p	CLIP-seq
MIRT2104207	hsa-miR-371b-5p	CLIP-seq
MIRT2328355	hsa-miR-4328	CLIP-seq
MIRT2328356	hsa-miR-4418	CLIP-seq
MIRT2328357	hsa-miR-4425	CLIP-seq
MIRT2328358	hsa-miR-4447	CLIP-seq
MIRT2328359	hsa-miR-4472	CLIP-seq
MIRT2328360	hsa-miR-4492	CLIP-seq
MIRT2328361	hsa-miR-4498	CLIP-seq
MIRT2328362	hsa-miR-4646-3p	CLIP-seq
MIRT2328363	hsa-miR-4648	CLIP-seq
MIRT2328364	hsa-miR-4649-3p	CLIP-seq
MIRT2328365	hsa-miR-4654	CLIP-seq
MIRT2328366	hsa-miR-4656	CLIP-seq
MIRT2328367	hsa-miR-4667-5p	CLIP-seq
MIRT2328368	hsa-miR-4668-5p	CLIP-seq
MIRT2328369	hsa-miR-4674	CLIP-seq
MIRT2328370	hsa-miR-4675	CLIP-seq
MIRT2328371	hsa-miR-4688	CLIP-seq
MIRT2328372	hsa-miR-4695-3p	CLIP-seq
MIRT2328373	hsa-miR-4700-5p	CLIP-seq
MIRT2328374	hsa-miR-4741	CLIP-seq
MIRT2328375	hsa-miR-4769-5p	CLIP-seq
MIRT2104210	hsa-miR-486-3p	CLIP-seq
MIRT1351550	hsa-miR-491-5p	CLIP-seq
MIRT2328376	hsa-miR-509-3-5p	CLIP-seq
MIRT2328377	hsa-miR-509-5p	CLIP-seq
MIRT2328378	hsa-miR-580	CLIP-seq
MIRT2328379	hsa-miR-615-5p	CLIP-seq
MIRT2328380	hsa-miR-637	CLIP-seq
MIRT2328381	hsa-miR-647	CLIP-seq
MIRT2328382	hsa-miR-762	CLIP-seq
MIRT2328344	hsa-miR-1205	CLIP-seq
MIRT2394597	hsa-miR-1286	CLIP-seq
MIRT2394598	hsa-miR-558	CLIP-seq
MIRT2328351	hsa-miR-3127-5p	CLIP-seq
MIRT2459450	hsa-miR-4305	CLIP-seq
MIRT2328371	hsa-miR-4688	CLIP-seq
MIRT2104210	hsa-miR-486-3p	CLIP-seq

Show/Hide all (17)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002232	Process	Leukocyte chemotaxis involved in inflammatory response	ISS
GO:0002336	Process	B-1 B cell lineage commitment	ISS	11313408
GO:0005515	Function	Protein binding	IPI	32296183, 33961781
GO:0006955	Process	Immune response	IBA
GO:0009986	Component	Cell surface	NAS	11313408
GO:0010760	Process	Negative regulation of macrophage chemotaxis	ISS
GO:0016020	Component	Membrane	IEA
GO:0038023	Function	Signaling receptor activity	IBA
GO:0038023	Function	Signaling receptor activity	ISS
GO:0042742	Process	Defense response to bacterium	ISS
GO:0042802	Function	Identical protein binding	ISS
GO:0045577	Process	Regulation of B cell differentiation	ISS	11313408
GO:0060266	Process	Negative regulation of respiratory burst involved in inflammatory response	ISS
GO:0090027	Process	Negative regulation of monocyte chemotaxis	ISS
GO:0090383	Process	Phagosome acidification	ISS
GO:1902623	Process	Negative regulation of neutrophil migration	ISS
GO:2000509	Process	Negative regulation of dendritic cell chemotaxis	ISS

MIM	HGNC	e!Ensembl
606620	21391	ENSG00000158714

Q9P0V8

Protein name

SLAM family member 8 (B-lymphocyte activator macrophage expressed) (BCM-like membrane protein) (CD antigen CD353)

Protein function

May play a role in B-lineage commitment and/or modulation of signaling through the B-cell receptor.

Family and domains

Tissue specificity

TISSUE SPECIFICITY: Expressed in lymph node, spleen, thymus and bone marrow. {ECO:0000269|PubMed:11313408}.

Sequence

MVMRPLWSLLLWEALLPITVTGAQVLSKVGGSVLLVAARPPGFQVREAIWRSLWPSEELL
ATFFRGSLETLYHSRFLGRAQLHSNLSLELGPLESGDSGNFSVLMVDTRGQPWTQTLQLK
VYDAVPRPVVQVFIAVERDAQPSKTCQVFLSCWAPNISEITYSWRRETTMDFGMEPHSLF
TDGQVLSISLGPGDRDVAYSCIVSNPVSWDLATVTPWDSCHHEAAPGKASYKDVLLVVVP
VSLLLMLVTLFSAWHWCPCSGKKKKDVHADRVGPETENPLVQDLP

Sequence length

285

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (6)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Clear cell carcinoma of kidney	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASES	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (12)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	35506438	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	Pubtator	36304068	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	GWASCAT_DG	28067908		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	30105842		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	30105842	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	BEFREE	30105842		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune system disease	Pubtator	30105842	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	CTD_human_DG	28067908		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant Neoplasms	Malignant Neoplasm	BEFREE	30105842		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mastocytosis	Mastocytosis	BEFREE	29498772		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	38017548	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	30873760	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only

SLAMF8 (SLAM family member 8)