Gene Gene information from NCBI Gene database.
Entrez ID 5678
Gene name Pregnancy specific beta-1-glycoprotein 9
Gene symbol PSG9
Synonyms (NCBI Gene)
PS34PSBG-11PSBG-9PSG11PSGII
Chromosome 19
Chromosome location 19q13.31
Summary The protein encoded by this gene is a member of the pregnancy-specific glycoprotein (PSG) family. This protein family and the closely related carcinoembryonic antigen cell adhesion molecule (CEACAM) gene family are both members of the immunoglobulin super
miRNA miRNA information provided by mirtarbase database.
3
miRTarBase ID miRNA Experiments Reference
MIRT019350 hsa-miR-148b-3p Microarray 17612493
MIRT022466 hsa-miR-124-3p Microarray 18668037
MIRT023717 hsa-miR-1-3p Microarray 18668037
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
10
GO ID Ontology Definition Evidence Reference
GO:0002461 Process Tolerance induction dependent upon immune response IDA 27389696
GO:0002774 Process Fc receptor mediated inhibitory signaling pathway IDA 27389696
GO:0005576 Component Extracellular region IEA
GO:0007179 Process Transforming growth factor beta receptor signaling pathway IDA 27389696
GO:0007565 Process Female pregnancy TAS 1690992, 1922019
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
176398 9526 ENSG00000183668
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q00887
Protein name Pregnancy-specific beta-1-glycoprotein 9 (PS-beta-G-9) (PSBG-9) (Pregnancy-specific glycoprotein 9) (PS34) (Pregnancy-specific beta-1 glycoprotein B) (PS-beta-B) (Pregnancy-specific beta-1-glycoprotein 11) (PS-beta-G-11) (PSBG-11) (Pregnancy-specific glyc
Protein function Binds to the small latent transforming growth factor-beta complex, consisting of the N-terminal TGFB1 latency-associated peptide (LAP) and the mature form of TGFB1, thereby leading to the activation of TGFB1 (PubMed:27389696). The activation of
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07686 V-set 38 141 Immunoglobulin V-set domain Domain
PF13895 Ig_2 334 413 Immunoglobulin domain Domain
Sequence
MGPLPAPSCTQRITWKGLLLTASLLNFWNPPTTAEVTIEAQPPKVSEGKDVLLLVHNLPQ
NLPGYFWYKGEMTDLYHYIISYIVDGKIIIYGPAYSGRETVYSNASLLIQNVTRKDAGTY
TLHIIKRGDETREEIRHFTFT
LYLETPKPYISSSNLNPREAMEAVRLICDPETLDASYLW
WMNGQSLPVTHRLQLSKTNRTLYLFGVTKYIAGPYECEIRNPVSASRSDPVTLNLLPKLP
IPYITINNLNPRENKDVLAFTCEPKSENYTYIWWLNGQSLPVSPGVKRPIENRILILPSV
TRNETGPYQCEIRDRYGGLRSNPVILNVLYGPDLPRIYPSFTYYRSGENLDLSCFTESNP
PAEYFWTINGKFQQSGQKLFIPQITRNHSGLYACSVHNSATGKEISKSMTVKV
SGPCHGD
LTESQS
Sequence length 426
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Cell surface interactions at the vascular wall
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
2
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
AUTISM SPECTRUM DISORDER CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1 Uncertain significance ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Adenoma Adenoma BEFREE 15982419
★☆☆☆☆
Found in Text Mining only
Adenomatous Polyposis Coli Multiple polyposis syndrome LHGDN 15982419
★☆☆☆☆
Found in Text Mining only
Colorectal Neoplasms Colorectal neoplasm Pubtator 15982419 Associate
★☆☆☆☆
Found in Text Mining only
Liver carcinoma Liver carcinoma BEFREE 28078509, 29770948
★☆☆☆☆
Found in Text Mining only
Malignant Neoplasms Malignant Neoplasm BEFREE 15982419
★☆☆☆☆
Found in Text Mining only
Strabismus Strabismus BEFREE 28988187
★☆☆☆☆
Found in Text Mining only