B2M (beta-2-microglobulin)

Gene

• Entrez ID: 567
• Gene name: Beta-2-microglobulin
• Gene symbol: B2M
• Synonyms (NCBI Gene): AMYLD6, IMD43, MHC1D4
• Chromosome: 15
• Chromosome location: 15q21.1
• Summary: This gene encodes a serum protein found in association with the major histocompatibility complex (MHC) class I heavy chain on the surface of nearly all nucleated cells. The protein has a predominantly beta-pleated sheet structure that can form amyloid fib

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs398122820	G>A	Pathogenic	Coding sequence variant, missense variant, non coding transcript variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT028088	hsa-miR-93-5p	Sequencing	20371350
MIRT072257	hsa-miR-3609	PAR-CLIP	20371350
MIRT072258	hsa-miR-548ah-5p	PAR-CLIP	20371350
MIRT072248	hsa-miR-106a-5p	PAR-CLIP	20371350
MIRT072250	hsa-miR-106b-5p	PAR-CLIP	20371350
MIRT072246	hsa-miR-17-5p	PAR-CLIP	20371350
MIRT072247	hsa-miR-20a-5p	PAR-CLIP	20371350
MIRT072251	hsa-miR-20b-5p	PAR-CLIP	20371350
MIRT072253	hsa-miR-519d-3p	PAR-CLIP	20371350
MIRT072252	hsa-miR-526b-3p	PAR-CLIP	20371350
MIRT028088	hsa-miR-93-5p	PAR-CLIP	20371350
MIRT072259	hsa-miR-4796-3p	PAR-CLIP	20371350
MIRT481115	hsa-miR-595	PAR-CLIP	20371350
MIRT072249	hsa-miR-142-5p	PAR-CLIP	20371350
MIRT072260	hsa-miR-5590-3p	PAR-CLIP	20371350
MIRT072255	hsa-miR-2113	PAR-CLIP	20371350
MIRT481114	hsa-miR-5010-3p	PAR-CLIP	20371350
MIRT072275	hsa-miR-4495	PAR-CLIP	20371350
MIRT481107	hsa-miR-379-3p	PAR-CLIP	20371350
MIRT481106	hsa-miR-411-3p	PAR-CLIP	20371350
MIRT481105	hsa-miR-380-3p	PAR-CLIP	20371350
MIRT072276	hsa-miR-4670-3p	PAR-CLIP	20371350
MIRT072261	hsa-miR-6792-5p	PAR-CLIP	20371350
MIRT072278	hsa-miR-6079	PAR-CLIP	20371350
MIRT380548	hsa-miR-4263	PAR-CLIP	20371350
MIRT072257	hsa-miR-3609	PAR-CLIP	20371350
MIRT072258	hsa-miR-548ah-5p	PAR-CLIP	20371350
MIRT072248	hsa-miR-106a-5p	PAR-CLIP	20371350
MIRT072250	hsa-miR-106b-5p	PAR-CLIP	20371350
MIRT072246	hsa-miR-17-5p	PAR-CLIP	20371350
MIRT072247	hsa-miR-20a-5p	PAR-CLIP	20371350
MIRT072251	hsa-miR-20b-5p	PAR-CLIP	20371350
MIRT072253	hsa-miR-519d-3p	PAR-CLIP	20371350
MIRT072252	hsa-miR-526b-3p	PAR-CLIP	20371350
MIRT028088	hsa-miR-93-5p	PAR-CLIP	20371350
MIRT072259	hsa-miR-4796-3p	PAR-CLIP	20371350
MIRT481115	hsa-miR-595	PAR-CLIP	20371350
MIRT072249	hsa-miR-142-5p	PAR-CLIP	20371350
MIRT072260	hsa-miR-5590-3p	PAR-CLIP	20371350
MIRT072254	hsa-miR-568	PAR-CLIP	20371350
MIRT072255	hsa-miR-2113	PAR-CLIP	20371350
MIRT072257	hsa-miR-3609	PAR-CLIP	20371350
MIRT072258	hsa-miR-548ah-5p	PAR-CLIP	20371350
MIRT072248	hsa-miR-106a-5p	PAR-CLIP	20371350
MIRT072250	hsa-miR-106b-5p	PAR-CLIP	20371350
MIRT072246	hsa-miR-17-5p	PAR-CLIP	20371350
MIRT072247	hsa-miR-20a-5p	PAR-CLIP	20371350
MIRT072251	hsa-miR-20b-5p	PAR-CLIP	20371350
MIRT072253	hsa-miR-519d-3p	PAR-CLIP	20371350
MIRT072252	hsa-miR-526b-3p	PAR-CLIP	20371350
MIRT028088	hsa-miR-93-5p	PAR-CLIP	20371350
MIRT072259	hsa-miR-4796-3p	PAR-CLIP	20371350
MIRT481115	hsa-miR-595	PAR-CLIP	20371350
MIRT072249	hsa-miR-142-5p	PAR-CLIP	20371350
MIRT072260	hsa-miR-5590-3p	PAR-CLIP	20371350
MIRT072254	hsa-miR-568	PAR-CLIP	20371350
MIRT072255	hsa-miR-2113	PAR-CLIP	20371350
MIRT072275	hsa-miR-4495	PAR-CLIP	20371350
MIRT481107	hsa-miR-379-3p	PAR-CLIP	20371350
MIRT481106	hsa-miR-411-3p	PAR-CLIP	20371350
MIRT481105	hsa-miR-380-3p	PAR-CLIP	20371350
MIRT072276	hsa-miR-4670-3p	PAR-CLIP	20371350
MIRT072261	hsa-miR-6792-5p	PAR-CLIP	20371350
MIRT072278	hsa-miR-6079	PAR-CLIP	20371350
MIRT072257	hsa-miR-3609	PAR-CLIP	20371350
MIRT072258	hsa-miR-548ah-5p	PAR-CLIP	20371350
MIRT072248	hsa-miR-106a-5p	PAR-CLIP	20371350
MIRT072250	hsa-miR-106b-5p	PAR-CLIP	20371350
MIRT072246	hsa-miR-17-5p	PAR-CLIP	20371350
MIRT072247	hsa-miR-20a-5p	PAR-CLIP	20371350
MIRT072251	hsa-miR-20b-5p	PAR-CLIP	20371350
MIRT072253	hsa-miR-519d-3p	PAR-CLIP	20371350
MIRT072252	hsa-miR-526b-3p	PAR-CLIP	20371350
MIRT028088	hsa-miR-93-5p	PAR-CLIP	20371350
MIRT072259	hsa-miR-4796-3p	PAR-CLIP	20371350
MIRT481115	hsa-miR-595	PAR-CLIP	20371350
MIRT072249	hsa-miR-142-5p	PAR-CLIP	20371350
MIRT072260	hsa-miR-5590-3p	PAR-CLIP	20371350
MIRT072255	hsa-miR-2113	PAR-CLIP	20371350
MIRT481114	hsa-miR-5010-3p	PAR-CLIP	20371350
MIRT072275	hsa-miR-4495	PAR-CLIP	20371350
MIRT481107	hsa-miR-379-3p	PAR-CLIP	20371350
MIRT481106	hsa-miR-411-3p	PAR-CLIP	20371350
MIRT481105	hsa-miR-380-3p	PAR-CLIP	20371350
MIRT072276	hsa-miR-4670-3p	PAR-CLIP	20371350
MIRT072261	hsa-miR-6792-5p	PAR-CLIP	20371350
MIRT072278	hsa-miR-6079	PAR-CLIP	20371350
MIRT072274	hsa-miR-491-3p	PAR-CLIP	20371350
MIRT072257	hsa-miR-3609	PAR-CLIP	20371350
MIRT072258	hsa-miR-548ah-5p	PAR-CLIP	20371350
MIRT072248	hsa-miR-106a-5p	PAR-CLIP	20371350
MIRT072250	hsa-miR-106b-5p	PAR-CLIP	20371350
MIRT072246	hsa-miR-17-5p	PAR-CLIP	20371350
MIRT072247	hsa-miR-20a-5p	PAR-CLIP	20371350
MIRT072251	hsa-miR-20b-5p	PAR-CLIP	20371350
MIRT072253	hsa-miR-519d-3p	PAR-CLIP	20371350
MIRT072252	hsa-miR-526b-3p	PAR-CLIP	20371350
MIRT028088	hsa-miR-93-5p	PAR-CLIP	20371350
MIRT072259	hsa-miR-4796-3p	PAR-CLIP	20371350
MIRT481115	hsa-miR-595	PAR-CLIP	20371350
MIRT072249	hsa-miR-142-5p	PAR-CLIP	20371350
MIRT072260	hsa-miR-5590-3p	PAR-CLIP	20371350
MIRT072254	hsa-miR-568	PAR-CLIP	20371350
MIRT072255	hsa-miR-2113	PAR-CLIP	20371350
MIRT481114	hsa-miR-5010-3p	PAR-CLIP	20371350
MIRT072275	hsa-miR-4495	PAR-CLIP	20371350
MIRT481107	hsa-miR-379-3p	PAR-CLIP	20371350
MIRT481106	hsa-miR-411-3p	PAR-CLIP	20371350
MIRT481105	hsa-miR-380-3p	PAR-CLIP	20371350
MIRT072276	hsa-miR-4670-3p	PAR-CLIP	20371350
MIRT072261	hsa-miR-6792-5p	PAR-CLIP	20371350
MIRT072278	hsa-miR-6079	PAR-CLIP	20371350
MIRT072257	hsa-miR-3609	PAR-CLIP	21572407
MIRT072258	hsa-miR-548ah-5p	PAR-CLIP	21572407
MIRT072248	hsa-miR-106a-5p	PAR-CLIP	21572407
MIRT072250	hsa-miR-106b-5p	PAR-CLIP	21572407
MIRT072246	hsa-miR-17-5p	PAR-CLIP	21572407
MIRT072247	hsa-miR-20a-5p	PAR-CLIP	21572407
MIRT072251	hsa-miR-20b-5p	PAR-CLIP	21572407
MIRT072253	hsa-miR-519d-3p	PAR-CLIP	21572407
MIRT072252	hsa-miR-526b-3p	PAR-CLIP	21572407
MIRT028088	hsa-miR-93-5p	PAR-CLIP	21572407
MIRT072259	hsa-miR-4796-3p	PAR-CLIP	21572407
MIRT481115	hsa-miR-595	PAR-CLIP	21572407
MIRT072249	hsa-miR-142-5p	PAR-CLIP	21572407
MIRT072260	hsa-miR-5590-3p	PAR-CLIP	21572407
MIRT072255	hsa-miR-2113	PAR-CLIP	21572407
MIRT481114	hsa-miR-5010-3p	PAR-CLIP	21572407
MIRT072257	hsa-miR-3609	PAR-CLIP	21572407
MIRT072258	hsa-miR-548ah-5p	PAR-CLIP	21572407
MIRT072248	hsa-miR-106a-5p	PAR-CLIP	21572407
MIRT072250	hsa-miR-106b-5p	PAR-CLIP	21572407
MIRT072246	hsa-miR-17-5p	PAR-CLIP	21572407
MIRT072247	hsa-miR-20a-5p	PAR-CLIP	21572407
MIRT072251	hsa-miR-20b-5p	PAR-CLIP	21572407
MIRT072253	hsa-miR-519d-3p	PAR-CLIP	21572407
MIRT072252	hsa-miR-526b-3p	PAR-CLIP	21572407
MIRT028088	hsa-miR-93-5p	PAR-CLIP	21572407
MIRT072259	hsa-miR-4796-3p	PAR-CLIP	21572407
MIRT481115	hsa-miR-595	PAR-CLIP	21572407
MIRT072249	hsa-miR-142-5p	PAR-CLIP	21572407
MIRT072260	hsa-miR-5590-3p	PAR-CLIP	21572407
MIRT072254	hsa-miR-568	PAR-CLIP	21572407
MIRT072255	hsa-miR-2113	PAR-CLIP	21572407
MIRT481114	hsa-miR-5010-3p	PAR-CLIP	21572407
MIRT072275	hsa-miR-4495	PAR-CLIP	21572407
MIRT481107	hsa-miR-379-3p	PAR-CLIP	21572407
MIRT481106	hsa-miR-411-3p	PAR-CLIP	21572407
MIRT481105	hsa-miR-380-3p	PAR-CLIP	21572407
MIRT072276	hsa-miR-4670-3p	PAR-CLIP	21572407
MIRT072261	hsa-miR-6792-5p	PAR-CLIP	21572407
MIRT072278	hsa-miR-6079	PAR-CLIP	21572407
MIRT072275	hsa-miR-4495	PAR-CLIP	23446348
MIRT481107	hsa-miR-379-3p	PAR-CLIP	23446348
MIRT481106	hsa-miR-411-3p	PAR-CLIP	23446348
MIRT481105	hsa-miR-380-3p	PAR-CLIP	23446348
MIRT072276	hsa-miR-4670-3p	PAR-CLIP	23446348
MIRT072261	hsa-miR-6792-5p	PAR-CLIP	23446348
MIRT072278	hsa-miR-6079	PAR-CLIP	23446348
MIRT072257	hsa-miR-3609	PAR-CLIP	23446348
MIRT072258	hsa-miR-548ah-5p	PAR-CLIP	23446348
MIRT072248	hsa-miR-106a-5p	PAR-CLIP	23446348
MIRT072250	hsa-miR-106b-5p	PAR-CLIP	23446348
MIRT072246	hsa-miR-17-5p	PAR-CLIP	23446348
MIRT072247	hsa-miR-20a-5p	PAR-CLIP	23446348
MIRT072251	hsa-miR-20b-5p	PAR-CLIP	23446348
MIRT072253	hsa-miR-519d-3p	PAR-CLIP	23446348
MIRT072252	hsa-miR-526b-3p	PAR-CLIP	23446348
MIRT028088	hsa-miR-93-5p	PAR-CLIP	23446348
MIRT072259	hsa-miR-4796-3p	PAR-CLIP	23446348
MIRT481115	hsa-miR-595	PAR-CLIP	23446348
MIRT072249	hsa-miR-142-5p	PAR-CLIP	23446348
MIRT072260	hsa-miR-5590-3p	PAR-CLIP	23446348
MIRT072254	hsa-miR-568	PAR-CLIP	23446348
MIRT072255	hsa-miR-2113	PAR-CLIP	23446348
MIRT072275	hsa-miR-4495	PAR-CLIP	23446348
MIRT481107	hsa-miR-379-3p	PAR-CLIP	23446348
MIRT481106	hsa-miR-411-3p	PAR-CLIP	23446348
MIRT481105	hsa-miR-380-3p	PAR-CLIP	23446348
MIRT072276	hsa-miR-4670-3p	PAR-CLIP	23446348
MIRT072261	hsa-miR-6792-5p	PAR-CLIP	23446348
MIRT072278	hsa-miR-6079	PAR-CLIP	23446348
MIRT380548	hsa-miR-4263	PAR-CLIP	23446348
MIRT072257	hsa-miR-3609	PAR-CLIP	23446348
MIRT072258	hsa-miR-548ah-5p	PAR-CLIP	23446348
MIRT072248	hsa-miR-106a-5p	PAR-CLIP	23446348
MIRT072250	hsa-miR-106b-5p	PAR-CLIP	23446348
MIRT072246	hsa-miR-17-5p	PAR-CLIP	23446348
MIRT072247	hsa-miR-20a-5p	PAR-CLIP	23446348
MIRT072251	hsa-miR-20b-5p	PAR-CLIP	23446348
MIRT072253	hsa-miR-519d-3p	PAR-CLIP	23446348
MIRT072252	hsa-miR-526b-3p	PAR-CLIP	23446348
MIRT028088	hsa-miR-93-5p	PAR-CLIP	23446348
MIRT072259	hsa-miR-4796-3p	PAR-CLIP	23446348
MIRT481115	hsa-miR-595	PAR-CLIP	23446348
MIRT072249	hsa-miR-142-5p	PAR-CLIP	23446348
MIRT072260	hsa-miR-5590-3p	PAR-CLIP	23446348
MIRT072255	hsa-miR-2113	PAR-CLIP	23446348
MIRT481114	hsa-miR-5010-3p	PAR-CLIP	23446348
MIRT072275	hsa-miR-4495	PAR-CLIP	23446348
MIRT481107	hsa-miR-379-3p	PAR-CLIP	23446348
MIRT481106	hsa-miR-411-3p	PAR-CLIP	23446348
MIRT481105	hsa-miR-380-3p	PAR-CLIP	23446348
MIRT072276	hsa-miR-4670-3p	PAR-CLIP	23446348
MIRT072261	hsa-miR-6792-5p	PAR-CLIP	23446348
MIRT072278	hsa-miR-6079	PAR-CLIP	23446348
MIRT072257	hsa-miR-3609	PAR-CLIP	23446348
MIRT072258	hsa-miR-548ah-5p	PAR-CLIP	23446348
MIRT072248	hsa-miR-106a-5p	PAR-CLIP	23446348
MIRT072250	hsa-miR-106b-5p	PAR-CLIP	23446348
MIRT072246	hsa-miR-17-5p	PAR-CLIP	23446348
MIRT072247	hsa-miR-20a-5p	PAR-CLIP	23446348
MIRT072251	hsa-miR-20b-5p	PAR-CLIP	23446348
MIRT072253	hsa-miR-519d-3p	PAR-CLIP	23446348
MIRT072252	hsa-miR-526b-3p	PAR-CLIP	23446348
MIRT028088	hsa-miR-93-5p	PAR-CLIP	23446348
MIRT072259	hsa-miR-4796-3p	PAR-CLIP	23446348
MIRT481115	hsa-miR-595	PAR-CLIP	23446348
MIRT072249	hsa-miR-142-5p	PAR-CLIP	23446348
MIRT072260	hsa-miR-5590-3p	PAR-CLIP	23446348
MIRT072255	hsa-miR-2113	PAR-CLIP	23446348
MIRT481114	hsa-miR-5010-3p	PAR-CLIP	23446348
MIRT072257	hsa-miR-3609	PAR-CLIP	24398324
MIRT072258	hsa-miR-548ah-5p	PAR-CLIP	24398324
MIRT072248	hsa-miR-106a-5p	PAR-CLIP	24398324
MIRT072250	hsa-miR-106b-5p	PAR-CLIP	24398324
MIRT072246	hsa-miR-17-5p	PAR-CLIP	24398324
MIRT072247	hsa-miR-20a-5p	PAR-CLIP	24398324
MIRT072251	hsa-miR-20b-5p	PAR-CLIP	24398324
MIRT072253	hsa-miR-519d-3p	PAR-CLIP	24398324
MIRT072252	hsa-miR-526b-3p	PAR-CLIP	24398324
MIRT028088	hsa-miR-93-5p	PAR-CLIP	24398324
MIRT072259	hsa-miR-4796-3p	PAR-CLIP	24398324
MIRT481115	hsa-miR-595	PAR-CLIP	24398324
MIRT072249	hsa-miR-142-5p	PAR-CLIP	24398324
MIRT072260	hsa-miR-5590-3p	PAR-CLIP	24398324
MIRT072254	hsa-miR-568	PAR-CLIP	24398324
MIRT072255	hsa-miR-2113	PAR-CLIP	24398324
MIRT481114	hsa-miR-5010-3p	PAR-CLIP	24398324
MIRT072257	hsa-miR-3609	PAR-CLIP	23592263
MIRT072258	hsa-miR-548ah-5p	PAR-CLIP	23592263
MIRT072248	hsa-miR-106a-5p	PAR-CLIP	23592263
MIRT072250	hsa-miR-106b-5p	PAR-CLIP	23592263
MIRT072246	hsa-miR-17-5p	PAR-CLIP	23592263
MIRT072247	hsa-miR-20a-5p	PAR-CLIP	23592263
MIRT072251	hsa-miR-20b-5p	PAR-CLIP	23592263
MIRT072253	hsa-miR-519d-3p	PAR-CLIP	23592263
MIRT072252	hsa-miR-526b-3p	PAR-CLIP	23592263
MIRT028088	hsa-miR-93-5p	PAR-CLIP	23592263
MIRT072259	hsa-miR-4796-3p	PAR-CLIP	23592263
MIRT481115	hsa-miR-595	PAR-CLIP	23592263
MIRT072249	hsa-miR-142-5p	PAR-CLIP	23592263
MIRT072260	hsa-miR-5590-3p	PAR-CLIP	23592263
MIRT192760	hsa-miR-16-2-3p	PAR-CLIP	23592263
MIRT192762	hsa-miR-195-3p	PAR-CLIP	23592263
MIRT072254	hsa-miR-568	PAR-CLIP	23592263
MIRT072255	hsa-miR-2113	PAR-CLIP	23592263
MIRT481114	hsa-miR-5010-3p	PAR-CLIP	23592263
MIRT072275	hsa-miR-4495	PAR-CLIP	23592263
MIRT481107	hsa-miR-379-3p	PAR-CLIP	23592263
MIRT481106	hsa-miR-411-3p	PAR-CLIP	23592263
MIRT481105	hsa-miR-380-3p	PAR-CLIP	23592263
MIRT072276	hsa-miR-4670-3p	PAR-CLIP	23592263
MIRT072261	hsa-miR-6792-5p	PAR-CLIP	23592263
MIRT072278	hsa-miR-6079	PAR-CLIP	23592263
MIRT380548	hsa-miR-4263	PAR-CLIP	23592263
MIRT072257	hsa-miR-3609	PAR-CLIP	23592263
MIRT072258	hsa-miR-548ah-5p	PAR-CLIP	23592263
MIRT072248	hsa-miR-106a-5p	PAR-CLIP	23592263
MIRT072250	hsa-miR-106b-5p	PAR-CLIP	23592263
MIRT072246	hsa-miR-17-5p	PAR-CLIP	23592263
MIRT072247	hsa-miR-20a-5p	PAR-CLIP	23592263
MIRT072251	hsa-miR-20b-5p	PAR-CLIP	23592263
MIRT072253	hsa-miR-519d-3p	PAR-CLIP	23592263
MIRT072252	hsa-miR-526b-3p	PAR-CLIP	23592263
MIRT028088	hsa-miR-93-5p	PAR-CLIP	23592263
MIRT072259	hsa-miR-4796-3p	PAR-CLIP	23592263
MIRT481115	hsa-miR-595	PAR-CLIP	23592263
MIRT072249	hsa-miR-142-5p	PAR-CLIP	23592263
MIRT072260	hsa-miR-5590-3p	PAR-CLIP	23592263
MIRT072254	hsa-miR-568	PAR-CLIP	23592263
MIRT072255	hsa-miR-2113	PAR-CLIP	23592263
MIRT481114	hsa-miR-5010-3p	PAR-CLIP	23592263
MIRT192772	hsa-miR-340-5p	PAR-CLIP	23592263
MIRT481113	hsa-miR-3133	PAR-CLIP	23592263
MIRT481112	hsa-miR-186-5p	PAR-CLIP	23592263
MIRT481111	hsa-miR-4802-3p	PAR-CLIP	23592263
MIRT192773	hsa-miR-888-5p	PAR-CLIP	23592263
MIRT342419	hsa-miR-5694	PAR-CLIP	23592263
MIRT342414	hsa-miR-96-3p	PAR-CLIP	23592263
MIRT192775	hsa-miR-3973	PAR-CLIP	23592263
MIRT481110	hsa-miR-520g-3p	PAR-CLIP	23592263
MIRT481109	hsa-miR-520h	PAR-CLIP	23592263
MIRT192771	hsa-miR-383-3p	PAR-CLIP	23592263
MIRT395128	hsa-miR-4524a-3p	PAR-CLIP	23592263
MIRT481108	hsa-miR-139-3p	PAR-CLIP	23592263
MIRT072275	hsa-miR-4495	PAR-CLIP	23592263
MIRT481107	hsa-miR-379-3p	PAR-CLIP	23592263
MIRT481106	hsa-miR-411-3p	PAR-CLIP	23592263
MIRT481105	hsa-miR-380-3p	PAR-CLIP	23592263
MIRT072276	hsa-miR-4670-3p	PAR-CLIP	23592263
MIRT072261	hsa-miR-6792-5p	PAR-CLIP	23592263
MIRT072278	hsa-miR-6079	PAR-CLIP	23592263
MIRT380548	hsa-miR-4263	PAR-CLIP	23592263
MIRT481107	hsa-miR-379-3p	PAR-CLIP	27292025
MIRT481105	hsa-miR-380-3p	PAR-CLIP	27292025
MIRT481106	hsa-miR-411-3p	PAR-CLIP	27292025
MIRT380548	hsa-miR-4263	PAR-CLIP	27292025
MIRT072275	hsa-miR-4495	PAR-CLIP	27292025
MIRT072276	hsa-miR-4670-3p	PAR-CLIP	27292025
MIRT072274	hsa-miR-491-3p	PAR-CLIP	27292025
MIRT072278	hsa-miR-6079	PAR-CLIP	27292025
MIRT072261	hsa-miR-6792-5p	PAR-CLIP	27292025
MIRT072257	hsa-miR-3609	PAR-CLIP	20371350
MIRT072258	hsa-miR-548ah-5p	PAR-CLIP	20371350
MIRT072248	hsa-miR-106a-5p	PAR-CLIP	20371350
MIRT072250	hsa-miR-106b-5p	PAR-CLIP	20371350
MIRT072246	hsa-miR-17-5p	PAR-CLIP	20371350
MIRT072247	hsa-miR-20a-5p	PAR-CLIP	20371350
MIRT072251	hsa-miR-20b-5p	PAR-CLIP	20371350
MIRT072253	hsa-miR-519d-3p	PAR-CLIP	20371350
MIRT072252	hsa-miR-526b-3p	PAR-CLIP	20371350
MIRT028088	hsa-miR-93-5p	PAR-CLIP	20371350
MIRT072259	hsa-miR-4796-3p	PAR-CLIP	20371350
MIRT481115	hsa-miR-595	PAR-CLIP	20371350
MIRT072249	hsa-miR-142-5p	PAR-CLIP	20371350
MIRT072260	hsa-miR-5590-3p	PAR-CLIP	20371350
MIRT072255	hsa-miR-2113	PAR-CLIP	20371350
MIRT481114	hsa-miR-5010-3p	PAR-CLIP	20371350
MIRT072275	hsa-miR-4495	PAR-CLIP	20371350
MIRT481107	hsa-miR-379-3p	PAR-CLIP	20371350
MIRT481106	hsa-miR-411-3p	PAR-CLIP	20371350
MIRT481105	hsa-miR-380-3p	PAR-CLIP	20371350
MIRT072276	hsa-miR-4670-3p	PAR-CLIP	20371350
MIRT072261	hsa-miR-6792-5p	PAR-CLIP	20371350
MIRT072278	hsa-miR-6079	PAR-CLIP	20371350
MIRT380548	hsa-miR-4263	PAR-CLIP	20371350
MIRT072257	hsa-miR-3609	PAR-CLIP	20371350
MIRT072258	hsa-miR-548ah-5p	PAR-CLIP	20371350
MIRT072248	hsa-miR-106a-5p	PAR-CLIP	20371350
MIRT072250	hsa-miR-106b-5p	PAR-CLIP	20371350
MIRT072246	hsa-miR-17-5p	PAR-CLIP	20371350
MIRT072247	hsa-miR-20a-5p	PAR-CLIP	20371350
MIRT072251	hsa-miR-20b-5p	PAR-CLIP	20371350
MIRT072253	hsa-miR-519d-3p	PAR-CLIP	20371350
MIRT072252	hsa-miR-526b-3p	PAR-CLIP	20371350
MIRT028088	hsa-miR-93-5p	PAR-CLIP	20371350
MIRT072259	hsa-miR-4796-3p	PAR-CLIP	20371350
MIRT481115	hsa-miR-595	PAR-CLIP	20371350
MIRT072249	hsa-miR-142-5p	PAR-CLIP	20371350
MIRT072260	hsa-miR-5590-3p	PAR-CLIP	20371350
MIRT072254	hsa-miR-568	PAR-CLIP	20371350
MIRT072255	hsa-miR-2113	PAR-CLIP	20371350
MIRT072257	hsa-miR-3609	PAR-CLIP	20371350
MIRT072258	hsa-miR-548ah-5p	PAR-CLIP	20371350
MIRT072248	hsa-miR-106a-5p	PAR-CLIP	20371350
MIRT072250	hsa-miR-106b-5p	PAR-CLIP	20371350
MIRT072246	hsa-miR-17-5p	PAR-CLIP	20371350
MIRT072247	hsa-miR-20a-5p	PAR-CLIP	20371350
MIRT072251	hsa-miR-20b-5p	PAR-CLIP	20371350
MIRT072253	hsa-miR-519d-3p	PAR-CLIP	20371350
MIRT072252	hsa-miR-526b-3p	PAR-CLIP	20371350
MIRT028088	hsa-miR-93-5p	PAR-CLIP	20371350
MIRT072259	hsa-miR-4796-3p	PAR-CLIP	20371350
MIRT481115	hsa-miR-595	PAR-CLIP	20371350
MIRT072249	hsa-miR-142-5p	PAR-CLIP	20371350
MIRT072260	hsa-miR-5590-3p	PAR-CLIP	20371350
MIRT072254	hsa-miR-568	PAR-CLIP	20371350
MIRT072255	hsa-miR-2113	PAR-CLIP	20371350
MIRT072275	hsa-miR-4495	PAR-CLIP	20371350
MIRT481107	hsa-miR-379-3p	PAR-CLIP	20371350
MIRT481106	hsa-miR-411-3p	PAR-CLIP	20371350
MIRT481105	hsa-miR-380-3p	PAR-CLIP	20371350
MIRT072276	hsa-miR-4670-3p	PAR-CLIP	20371350
MIRT072261	hsa-miR-6792-5p	PAR-CLIP	20371350
MIRT072278	hsa-miR-6079	PAR-CLIP	20371350
MIRT072257	hsa-miR-3609	PAR-CLIP	20371350
MIRT072258	hsa-miR-548ah-5p	PAR-CLIP	20371350
MIRT072248	hsa-miR-106a-5p	PAR-CLIP	20371350
MIRT072250	hsa-miR-106b-5p	PAR-CLIP	20371350
MIRT072246	hsa-miR-17-5p	PAR-CLIP	20371350
MIRT072247	hsa-miR-20a-5p	PAR-CLIP	20371350
MIRT072251	hsa-miR-20b-5p	PAR-CLIP	20371350
MIRT072253	hsa-miR-519d-3p	PAR-CLIP	20371350
MIRT072252	hsa-miR-526b-3p	PAR-CLIP	20371350
MIRT028088	hsa-miR-93-5p	PAR-CLIP	20371350
MIRT072259	hsa-miR-4796-3p	PAR-CLIP	20371350
MIRT481115	hsa-miR-595	PAR-CLIP	20371350
MIRT072249	hsa-miR-142-5p	PAR-CLIP	20371350
MIRT072260	hsa-miR-5590-3p	PAR-CLIP	20371350
MIRT072255	hsa-miR-2113	PAR-CLIP	20371350
MIRT481114	hsa-miR-5010-3p	PAR-CLIP	20371350
MIRT072275	hsa-miR-4495	PAR-CLIP	20371350
MIRT481107	hsa-miR-379-3p	PAR-CLIP	20371350
MIRT481106	hsa-miR-411-3p	PAR-CLIP	20371350
MIRT481105	hsa-miR-380-3p	PAR-CLIP	20371350
MIRT072276	hsa-miR-4670-3p	PAR-CLIP	20371350
MIRT072261	hsa-miR-6792-5p	PAR-CLIP	20371350
MIRT072278	hsa-miR-6079	PAR-CLIP	20371350
MIRT072274	hsa-miR-491-3p	PAR-CLIP	20371350
MIRT072257	hsa-miR-3609	PAR-CLIP	20371350
MIRT072258	hsa-miR-548ah-5p	PAR-CLIP	20371350
MIRT072248	hsa-miR-106a-5p	PAR-CLIP	20371350
MIRT072250	hsa-miR-106b-5p	PAR-CLIP	20371350
MIRT072246	hsa-miR-17-5p	PAR-CLIP	20371350
MIRT072247	hsa-miR-20a-5p	PAR-CLIP	20371350
MIRT072251	hsa-miR-20b-5p	PAR-CLIP	20371350
MIRT072253	hsa-miR-519d-3p	PAR-CLIP	20371350
MIRT072252	hsa-miR-526b-3p	PAR-CLIP	20371350
MIRT028088	hsa-miR-93-5p	PAR-CLIP	20371350
MIRT072259	hsa-miR-4796-3p	PAR-CLIP	20371350
MIRT481115	hsa-miR-595	PAR-CLIP	20371350
MIRT072249	hsa-miR-142-5p	PAR-CLIP	20371350
MIRT072260	hsa-miR-5590-3p	PAR-CLIP	20371350
MIRT072254	hsa-miR-568	PAR-CLIP	20371350
MIRT072255	hsa-miR-2113	PAR-CLIP	20371350
MIRT481114	hsa-miR-5010-3p	PAR-CLIP	20371350
MIRT072275	hsa-miR-4495	PAR-CLIP	20371350
MIRT481107	hsa-miR-379-3p	PAR-CLIP	20371350
MIRT481106	hsa-miR-411-3p	PAR-CLIP	20371350
MIRT481105	hsa-miR-380-3p	PAR-CLIP	20371350
MIRT072276	hsa-miR-4670-3p	PAR-CLIP	20371350
MIRT072261	hsa-miR-6792-5p	PAR-CLIP	20371350
MIRT072278	hsa-miR-6079	PAR-CLIP	20371350
MIRT072257	hsa-miR-3609	PAR-CLIP	21572407
MIRT072258	hsa-miR-548ah-5p	PAR-CLIP	21572407
MIRT072248	hsa-miR-106a-5p	PAR-CLIP	21572407
MIRT072250	hsa-miR-106b-5p	PAR-CLIP	21572407
MIRT072246	hsa-miR-17-5p	PAR-CLIP	21572407
MIRT072247	hsa-miR-20a-5p	PAR-CLIP	21572407
MIRT072251	hsa-miR-20b-5p	PAR-CLIP	21572407
MIRT072253	hsa-miR-519d-3p	PAR-CLIP	21572407
MIRT072252	hsa-miR-526b-3p	PAR-CLIP	21572407
MIRT028088	hsa-miR-93-5p	PAR-CLIP	21572407
MIRT072259	hsa-miR-4796-3p	PAR-CLIP	21572407
MIRT481115	hsa-miR-595	PAR-CLIP	21572407
MIRT072249	hsa-miR-142-5p	PAR-CLIP	21572407
MIRT072260	hsa-miR-5590-3p	PAR-CLIP	21572407
MIRT072255	hsa-miR-2113	PAR-CLIP	21572407
MIRT481114	hsa-miR-5010-3p	PAR-CLIP	21572407
MIRT072257	hsa-miR-3609	PAR-CLIP	21572407
MIRT072258	hsa-miR-548ah-5p	PAR-CLIP	21572407
MIRT072248	hsa-miR-106a-5p	PAR-CLIP	21572407
MIRT072250	hsa-miR-106b-5p	PAR-CLIP	21572407
MIRT072246	hsa-miR-17-5p	PAR-CLIP	21572407
MIRT072247	hsa-miR-20a-5p	PAR-CLIP	21572407
MIRT072251	hsa-miR-20b-5p	PAR-CLIP	21572407
MIRT072253	hsa-miR-519d-3p	PAR-CLIP	21572407
MIRT072252	hsa-miR-526b-3p	PAR-CLIP	21572407
MIRT028088	hsa-miR-93-5p	PAR-CLIP	21572407
MIRT072259	hsa-miR-4796-3p	PAR-CLIP	21572407
MIRT481115	hsa-miR-595	PAR-CLIP	21572407
MIRT072249	hsa-miR-142-5p	PAR-CLIP	21572407
MIRT072260	hsa-miR-5590-3p	PAR-CLIP	21572407
MIRT072254	hsa-miR-568	PAR-CLIP	21572407
MIRT072255	hsa-miR-2113	PAR-CLIP	21572407
MIRT481114	hsa-miR-5010-3p	PAR-CLIP	21572407
MIRT072275	hsa-miR-4495	PAR-CLIP	21572407
MIRT481107	hsa-miR-379-3p	PAR-CLIP	21572407
MIRT481106	hsa-miR-411-3p	PAR-CLIP	21572407
MIRT481105	hsa-miR-380-3p	PAR-CLIP	21572407
MIRT072276	hsa-miR-4670-3p	PAR-CLIP	21572407
MIRT072261	hsa-miR-6792-5p	PAR-CLIP	21572407
MIRT072278	hsa-miR-6079	PAR-CLIP	21572407
MIRT072275	hsa-miR-4495	PAR-CLIP	23446348
MIRT481107	hsa-miR-379-3p	PAR-CLIP	23446348
MIRT481106	hsa-miR-411-3p	PAR-CLIP	23446348
MIRT481105	hsa-miR-380-3p	PAR-CLIP	23446348
MIRT072276	hsa-miR-4670-3p	PAR-CLIP	23446348
MIRT072261	hsa-miR-6792-5p	PAR-CLIP	23446348
MIRT072278	hsa-miR-6079	PAR-CLIP	23446348
MIRT072257	hsa-miR-3609	PAR-CLIP	23446348
MIRT072258	hsa-miR-548ah-5p	PAR-CLIP	23446348
MIRT072248	hsa-miR-106a-5p	PAR-CLIP	23446348
MIRT072250	hsa-miR-106b-5p	PAR-CLIP	23446348
MIRT072246	hsa-miR-17-5p	PAR-CLIP	23446348
MIRT072247	hsa-miR-20a-5p	PAR-CLIP	23446348
MIRT072251	hsa-miR-20b-5p	PAR-CLIP	23446348
MIRT072253	hsa-miR-519d-3p	PAR-CLIP	23446348
MIRT072252	hsa-miR-526b-3p	PAR-CLIP	23446348
MIRT028088	hsa-miR-93-5p	PAR-CLIP	23446348
MIRT072259	hsa-miR-4796-3p	PAR-CLIP	23446348
MIRT481115	hsa-miR-595	PAR-CLIP	23446348
MIRT072249	hsa-miR-142-5p	PAR-CLIP	23446348
MIRT072260	hsa-miR-5590-3p	PAR-CLIP	23446348
MIRT072254	hsa-miR-568	PAR-CLIP	23446348
MIRT072255	hsa-miR-2113	PAR-CLIP	23446348
MIRT072275	hsa-miR-4495	PAR-CLIP	23446348
MIRT481107	hsa-miR-379-3p	PAR-CLIP	23446348
MIRT481106	hsa-miR-411-3p	PAR-CLIP	23446348
MIRT481105	hsa-miR-380-3p	PAR-CLIP	23446348
MIRT072276	hsa-miR-4670-3p	PAR-CLIP	23446348
MIRT072261	hsa-miR-6792-5p	PAR-CLIP	23446348
MIRT072278	hsa-miR-6079	PAR-CLIP	23446348
MIRT380548	hsa-miR-4263	PAR-CLIP	23446348
MIRT072257	hsa-miR-3609	PAR-CLIP	23446348
MIRT072258	hsa-miR-548ah-5p	PAR-CLIP	23446348
MIRT072248	hsa-miR-106a-5p	PAR-CLIP	23446348
MIRT072250	hsa-miR-106b-5p	PAR-CLIP	23446348
MIRT072246	hsa-miR-17-5p	PAR-CLIP	23446348
MIRT072247	hsa-miR-20a-5p	PAR-CLIP	23446348
MIRT072251	hsa-miR-20b-5p	PAR-CLIP	23446348
MIRT072253	hsa-miR-519d-3p	PAR-CLIP	23446348
MIRT072252	hsa-miR-526b-3p	PAR-CLIP	23446348
MIRT028088	hsa-miR-93-5p	PAR-CLIP	23446348
MIRT072259	hsa-miR-4796-3p	PAR-CLIP	23446348
MIRT481115	hsa-miR-595	PAR-CLIP	23446348
MIRT072249	hsa-miR-142-5p	PAR-CLIP	23446348
MIRT072260	hsa-miR-5590-3p	PAR-CLIP	23446348
MIRT072255	hsa-miR-2113	PAR-CLIP	23446348
MIRT481114	hsa-miR-5010-3p	PAR-CLIP	23446348
MIRT072275	hsa-miR-4495	PAR-CLIP	23446348
MIRT481107	hsa-miR-379-3p	PAR-CLIP	23446348
MIRT481106	hsa-miR-411-3p	PAR-CLIP	23446348
MIRT481105	hsa-miR-380-3p	PAR-CLIP	23446348
MIRT072276	hsa-miR-4670-3p	PAR-CLIP	23446348
MIRT072261	hsa-miR-6792-5p	PAR-CLIP	23446348
MIRT072278	hsa-miR-6079	PAR-CLIP	23446348
MIRT072257	hsa-miR-3609	PAR-CLIP	23446348
MIRT072258	hsa-miR-548ah-5p	PAR-CLIP	23446348
MIRT072248	hsa-miR-106a-5p	PAR-CLIP	23446348
MIRT072250	hsa-miR-106b-5p	PAR-CLIP	23446348
MIRT072246	hsa-miR-17-5p	PAR-CLIP	23446348
MIRT072247	hsa-miR-20a-5p	PAR-CLIP	23446348
MIRT072251	hsa-miR-20b-5p	PAR-CLIP	23446348
MIRT072253	hsa-miR-519d-3p	PAR-CLIP	23446348
MIRT072252	hsa-miR-526b-3p	PAR-CLIP	23446348
MIRT028088	hsa-miR-93-5p	PAR-CLIP	23446348
MIRT072259	hsa-miR-4796-3p	PAR-CLIP	23446348
MIRT481115	hsa-miR-595	PAR-CLIP	23446348
MIRT072249	hsa-miR-142-5p	PAR-CLIP	23446348
MIRT072260	hsa-miR-5590-3p	PAR-CLIP	23446348
MIRT072255	hsa-miR-2113	PAR-CLIP	23446348
MIRT481114	hsa-miR-5010-3p	PAR-CLIP	23446348
MIRT072257	hsa-miR-3609	PAR-CLIP	24398324
MIRT072258	hsa-miR-548ah-5p	PAR-CLIP	24398324
MIRT072248	hsa-miR-106a-5p	PAR-CLIP	24398324
MIRT072250	hsa-miR-106b-5p	PAR-CLIP	24398324
MIRT072246	hsa-miR-17-5p	PAR-CLIP	24398324
MIRT072247	hsa-miR-20a-5p	PAR-CLIP	24398324
MIRT072251	hsa-miR-20b-5p	PAR-CLIP	24398324
MIRT072253	hsa-miR-519d-3p	PAR-CLIP	24398324
MIRT072252	hsa-miR-526b-3p	PAR-CLIP	24398324
MIRT028088	hsa-miR-93-5p	PAR-CLIP	24398324
MIRT072259	hsa-miR-4796-3p	PAR-CLIP	24398324
MIRT481115	hsa-miR-595	PAR-CLIP	24398324
MIRT072249	hsa-miR-142-5p	PAR-CLIP	24398324
MIRT072260	hsa-miR-5590-3p	PAR-CLIP	24398324
MIRT072254	hsa-miR-568	PAR-CLIP	24398324
MIRT072255	hsa-miR-2113	PAR-CLIP	24398324
MIRT481114	hsa-miR-5010-3p	PAR-CLIP	24398324
MIRT072257	hsa-miR-3609	PAR-CLIP	23592263
MIRT072258	hsa-miR-548ah-5p	PAR-CLIP	23592263
MIRT072248	hsa-miR-106a-5p	PAR-CLIP	23592263
MIRT072250	hsa-miR-106b-5p	PAR-CLIP	23592263
MIRT072246	hsa-miR-17-5p	PAR-CLIP	23592263
MIRT072247	hsa-miR-20a-5p	PAR-CLIP	23592263
MIRT072251	hsa-miR-20b-5p	PAR-CLIP	23592263
MIRT072253	hsa-miR-519d-3p	PAR-CLIP	23592263
MIRT072252	hsa-miR-526b-3p	PAR-CLIP	23592263
MIRT028088	hsa-miR-93-5p	PAR-CLIP	23592263
MIRT072259	hsa-miR-4796-3p	PAR-CLIP	23592263
MIRT481115	hsa-miR-595	PAR-CLIP	23592263
MIRT072249	hsa-miR-142-5p	PAR-CLIP	23592263
MIRT072260	hsa-miR-5590-3p	PAR-CLIP	23592263
MIRT192760	hsa-miR-16-2-3p	PAR-CLIP	23592263
MIRT192762	hsa-miR-195-3p	PAR-CLIP	23592263
MIRT072254	hsa-miR-568	PAR-CLIP	23592263
MIRT072255	hsa-miR-2113	PAR-CLIP	23592263
MIRT481114	hsa-miR-5010-3p	PAR-CLIP	23592263
MIRT072275	hsa-miR-4495	PAR-CLIP	23592263
MIRT481107	hsa-miR-379-3p	PAR-CLIP	23592263
MIRT481106	hsa-miR-411-3p	PAR-CLIP	23592263
MIRT481105	hsa-miR-380-3p	PAR-CLIP	23592263
MIRT072276	hsa-miR-4670-3p	PAR-CLIP	23592263
MIRT072261	hsa-miR-6792-5p	PAR-CLIP	23592263
MIRT072278	hsa-miR-6079	PAR-CLIP	23592263
MIRT380548	hsa-miR-4263	PAR-CLIP	23592263
MIRT072257	hsa-miR-3609	PAR-CLIP	23592263
MIRT072258	hsa-miR-548ah-5p	PAR-CLIP	23592263
MIRT072248	hsa-miR-106a-5p	PAR-CLIP	23592263
MIRT072250	hsa-miR-106b-5p	PAR-CLIP	23592263
MIRT072246	hsa-miR-17-5p	PAR-CLIP	23592263
MIRT072247	hsa-miR-20a-5p	PAR-CLIP	23592263
MIRT072251	hsa-miR-20b-5p	PAR-CLIP	23592263
MIRT072253	hsa-miR-519d-3p	PAR-CLIP	23592263
MIRT072252	hsa-miR-526b-3p	PAR-CLIP	23592263
MIRT028088	hsa-miR-93-5p	PAR-CLIP	23592263
MIRT072259	hsa-miR-4796-3p	PAR-CLIP	23592263
MIRT481115	hsa-miR-595	PAR-CLIP	23592263
MIRT072249	hsa-miR-142-5p	PAR-CLIP	23592263
MIRT072260	hsa-miR-5590-3p	PAR-CLIP	23592263
MIRT072254	hsa-miR-568	PAR-CLIP	23592263
MIRT072255	hsa-miR-2113	PAR-CLIP	23592263
MIRT481114	hsa-miR-5010-3p	PAR-CLIP	23592263
MIRT192772	hsa-miR-340-5p	PAR-CLIP	23592263
MIRT481113	hsa-miR-3133	PAR-CLIP	23592263
MIRT481112	hsa-miR-186-5p	PAR-CLIP	23592263
MIRT481111	hsa-miR-4802-3p	PAR-CLIP	23592263
MIRT192773	hsa-miR-888-5p	PAR-CLIP	23592263
MIRT342419	hsa-miR-5694	PAR-CLIP	23592263
MIRT342414	hsa-miR-96-3p	PAR-CLIP	23592263
MIRT192775	hsa-miR-3973	PAR-CLIP	23592263
MIRT481110	hsa-miR-520g-3p	PAR-CLIP	23592263
MIRT481109	hsa-miR-520h	PAR-CLIP	23592263
MIRT192771	hsa-miR-383-3p	PAR-CLIP	23592263
MIRT395128	hsa-miR-4524a-3p	PAR-CLIP	23592263
MIRT481108	hsa-miR-139-3p	PAR-CLIP	23592263
MIRT072275	hsa-miR-4495	PAR-CLIP	23592263
MIRT481107	hsa-miR-379-3p	PAR-CLIP	23592263
MIRT481106	hsa-miR-411-3p	PAR-CLIP	23592263
MIRT481105	hsa-miR-380-3p	PAR-CLIP	23592263
MIRT072276	hsa-miR-4670-3p	PAR-CLIP	23592263
MIRT072261	hsa-miR-6792-5p	PAR-CLIP	23592263
MIRT072278	hsa-miR-6079	PAR-CLIP	23592263
MIRT380548	hsa-miR-4263	PAR-CLIP	23592263
MIRT812730	hsa-miR-105	CLIP-seq
MIRT812731	hsa-miR-106a	CLIP-seq
MIRT812732	hsa-miR-106b	CLIP-seq
MIRT812733	hsa-miR-1322	CLIP-seq
MIRT812734	hsa-miR-17	CLIP-seq
MIRT812735	hsa-miR-20a	CLIP-seq
MIRT812736	hsa-miR-20b	CLIP-seq
MIRT812737	hsa-miR-3190	CLIP-seq
MIRT812738	hsa-miR-361-3p	CLIP-seq
MIRT812739	hsa-miR-3653	CLIP-seq
MIRT812740	hsa-miR-3673	CLIP-seq
MIRT812741	hsa-miR-3679-3p	CLIP-seq
MIRT812742	hsa-miR-4446-5p	CLIP-seq
MIRT812743	hsa-miR-4752	CLIP-seq
MIRT812744	hsa-miR-4760-3p	CLIP-seq
MIRT812745	hsa-miR-4799-5p	CLIP-seq
MIRT812746	hsa-miR-513a-3p	CLIP-seq
MIRT812747	hsa-miR-519d	CLIP-seq
MIRT812748	hsa-miR-532-5p	CLIP-seq
MIRT812749	hsa-miR-548ah	CLIP-seq
MIRT812750	hsa-miR-576-5p	CLIP-seq
MIRT812751	hsa-miR-93	CLIP-seq
MIRT812730	hsa-miR-105	CLIP-seq
MIRT812740	hsa-miR-3673	CLIP-seq
MIRT812744	hsa-miR-4760-3p	CLIP-seq
MIRT812730	hsa-miR-105	CLIP-seq
MIRT1556012	hsa-miR-130a	CLIP-seq
MIRT1556013	hsa-miR-130b	CLIP-seq
MIRT1556014	hsa-miR-301a	CLIP-seq
MIRT1556015	hsa-miR-301b	CLIP-seq
MIRT1556016	hsa-miR-3666	CLIP-seq
MIRT1556017	hsa-miR-4295	CLIP-seq
MIRT1556018	hsa-miR-454	CLIP-seq
MIRT1556019	hsa-miR-4658	CLIP-seq
MIRT1556020	hsa-miR-4696	CLIP-seq
MIRT1556021	hsa-miR-4758-5p	CLIP-seq
MIRT812744	hsa-miR-4760-3p	CLIP-seq
MIRT812746	hsa-miR-513a-3p	CLIP-seq
MIRT812730	hsa-miR-105	CLIP-seq
MIRT1940284	hsa-miR-1202	CLIP-seq
MIRT1940285	hsa-miR-3194-5p	CLIP-seq
MIRT812738	hsa-miR-361-3p	CLIP-seq
MIRT812741	hsa-miR-3679-3p	CLIP-seq
MIRT1940286	hsa-miR-3972	CLIP-seq
MIRT1940287	hsa-miR-4290	CLIP-seq
MIRT1940288	hsa-miR-4330	CLIP-seq
MIRT1940289	hsa-miR-4667-3p	CLIP-seq
MIRT1940290	hsa-miR-4687-5p	CLIP-seq
MIRT812744	hsa-miR-4760-3p	CLIP-seq
MIRT1940291	hsa-miR-499-3p	CLIP-seq
MIRT1940292	hsa-miR-499a-3p	CLIP-seq
MIRT812746	hsa-miR-513a-3p	CLIP-seq
MIRT812748	hsa-miR-532-5p	CLIP-seq
MIRT1940293	hsa-miR-767-3p	CLIP-seq
MIRT812730	hsa-miR-105	CLIP-seq
MIRT1556012	hsa-miR-130a	CLIP-seq
MIRT1556013	hsa-miR-130b	CLIP-seq
MIRT2179199	hsa-miR-186	CLIP-seq
MIRT1556014	hsa-miR-301a	CLIP-seq
MIRT1556015	hsa-miR-301b	CLIP-seq
MIRT2179200	hsa-miR-3143	CLIP-seq
MIRT2179201	hsa-miR-340	CLIP-seq
MIRT1556016	hsa-miR-3666	CLIP-seq
MIRT812740	hsa-miR-3673	CLIP-seq
MIRT1556017	hsa-miR-4295	CLIP-seq
MIRT1556018	hsa-miR-454	CLIP-seq
MIRT1556019	hsa-miR-4658	CLIP-seq
MIRT1556020	hsa-miR-4696	CLIP-seq
MIRT2179202	hsa-miR-4716-5p	CLIP-seq
MIRT1556021	hsa-miR-4758-5p	CLIP-seq
MIRT812744	hsa-miR-4760-3p	CLIP-seq
MIRT2179203	hsa-miR-520g	CLIP-seq
MIRT2179204	hsa-miR-543	CLIP-seq
MIRT2179205	hsa-miR-888	CLIP-seq
MIRT2384699	hsa-miR-3671	CLIP-seq
MIRT2384700	hsa-miR-4256	CLIP-seq
MIRT2384701	hsa-miR-4709-3p	CLIP-seq
MIRT2384702	hsa-miR-4762-5p	CLIP-seq
MIRT2384703	hsa-miR-607	CLIP-seq
MIRT812730	hsa-miR-105	CLIP-seq
MIRT812731	hsa-miR-106a	CLIP-seq
MIRT812732	hsa-miR-106b	CLIP-seq
MIRT2426574	hsa-miR-1261	CLIP-seq
MIRT2426575	hsa-miR-1298	CLIP-seq
MIRT1556012	hsa-miR-130a	CLIP-seq
MIRT1556013	hsa-miR-130b	CLIP-seq
MIRT812734	hsa-miR-17	CLIP-seq
MIRT812735	hsa-miR-20a	CLIP-seq
MIRT812736	hsa-miR-20b	CLIP-seq
MIRT1556014	hsa-miR-301a	CLIP-seq
MIRT1556015	hsa-miR-301b	CLIP-seq
MIRT2179200	hsa-miR-3143	CLIP-seq
MIRT812737	hsa-miR-3190	CLIP-seq
MIRT2426576	hsa-miR-323b-3p	CLIP-seq
MIRT812738	hsa-miR-361-3p	CLIP-seq
MIRT812739	hsa-miR-3653	CLIP-seq
MIRT1556016	hsa-miR-3666	CLIP-seq
MIRT2384699	hsa-miR-3671	CLIP-seq
MIRT812741	hsa-miR-3679-3p	CLIP-seq
MIRT2426577	hsa-miR-380	CLIP-seq
MIRT2384700	hsa-miR-4256	CLIP-seq
MIRT2426578	hsa-miR-4275	CLIP-seq
MIRT1556017	hsa-miR-4295	CLIP-seq
MIRT2426579	hsa-miR-4421	CLIP-seq
MIRT812742	hsa-miR-4446-5p	CLIP-seq
MIRT2426580	hsa-miR-4517	CLIP-seq
MIRT2426581	hsa-miR-4528	CLIP-seq
MIRT1556018	hsa-miR-454	CLIP-seq
MIRT1556019	hsa-miR-4658	CLIP-seq
MIRT1556020	hsa-miR-4696	CLIP-seq
MIRT2426582	hsa-miR-4698	CLIP-seq
MIRT2384701	hsa-miR-4709-3p	CLIP-seq
MIRT2179202	hsa-miR-4716-5p	CLIP-seq
MIRT812743	hsa-miR-4752	CLIP-seq
MIRT1556021	hsa-miR-4758-5p	CLIP-seq
MIRT2384702	hsa-miR-4762-5p	CLIP-seq
MIRT2426583	hsa-miR-4781-3p	CLIP-seq
MIRT2426584	hsa-miR-4795-3p	CLIP-seq
MIRT812745	hsa-miR-4799-5p	CLIP-seq
MIRT2426585	hsa-miR-495	CLIP-seq
MIRT2426586	hsa-miR-500a	CLIP-seq
MIRT812746	hsa-miR-513a-3p	CLIP-seq
MIRT812747	hsa-miR-519d	CLIP-seq
MIRT812748	hsa-miR-532-5p	CLIP-seq
MIRT2179204	hsa-miR-543	CLIP-seq
MIRT812749	hsa-miR-548ah	CLIP-seq
MIRT812750	hsa-miR-576-5p	CLIP-seq
MIRT2384703	hsa-miR-607	CLIP-seq
MIRT2426587	hsa-miR-664	CLIP-seq
MIRT812751	hsa-miR-93	CLIP-seq
MIRT812746	hsa-miR-513a-3p	CLIP-seq
MIRT812746	hsa-miR-513a-3p	CLIP-seq
MIRT1940284	hsa-miR-1202	CLIP-seq
MIRT2435603	hsa-miR-1224-3p	CLIP-seq
MIRT2426574	hsa-miR-1261	CLIP-seq
MIRT1556012	hsa-miR-130a	CLIP-seq
MIRT1556013	hsa-miR-130b	CLIP-seq
MIRT1556014	hsa-miR-301a	CLIP-seq
MIRT1556015	hsa-miR-301b	CLIP-seq
MIRT2435604	hsa-miR-3123	CLIP-seq
MIRT1940285	hsa-miR-3194-5p	CLIP-seq
MIRT2179201	hsa-miR-340	CLIP-seq
MIRT1556016	hsa-miR-3666	CLIP-seq
MIRT2384699	hsa-miR-3671	CLIP-seq
MIRT2435605	hsa-miR-382	CLIP-seq
MIRT1940286	hsa-miR-3972	CLIP-seq
MIRT2384700	hsa-miR-4256	CLIP-seq
MIRT2435606	hsa-miR-4286	CLIP-seq
MIRT1940287	hsa-miR-4290	CLIP-seq
MIRT1556017	hsa-miR-4295	CLIP-seq
MIRT1940288	hsa-miR-4330	CLIP-seq
MIRT1556018	hsa-miR-454	CLIP-seq
MIRT1556019	hsa-miR-4658	CLIP-seq
MIRT1940289	hsa-miR-4667-3p	CLIP-seq
MIRT1940290	hsa-miR-4687-5p	CLIP-seq
MIRT1556020	hsa-miR-4696	CLIP-seq
MIRT2384701	hsa-miR-4709-3p	CLIP-seq
MIRT1556021	hsa-miR-4758-5p	CLIP-seq
MIRT2384702	hsa-miR-4762-5p	CLIP-seq
MIRT2426583	hsa-miR-4781-3p	CLIP-seq
MIRT1940291	hsa-miR-499-3p	CLIP-seq
MIRT1940292	hsa-miR-499a-3p	CLIP-seq
MIRT812746	hsa-miR-513a-3p	CLIP-seq
MIRT2179203	hsa-miR-520g	CLIP-seq
MIRT2384703	hsa-miR-607	CLIP-seq
MIRT1940293	hsa-miR-767-3p	CLIP-seq
MIRT2179205	hsa-miR-888	CLIP-seq
MIRT812730	hsa-miR-105	CLIP-seq
MIRT812731	hsa-miR-106a	CLIP-seq
MIRT812732	hsa-miR-106b	CLIP-seq
MIRT1940284	hsa-miR-1202	CLIP-seq
MIRT2435603	hsa-miR-1224-3p	CLIP-seq
MIRT2426574	hsa-miR-1261	CLIP-seq
MIRT2426575	hsa-miR-1298	CLIP-seq
MIRT1556012	hsa-miR-130a	CLIP-seq
MIRT1556013	hsa-miR-130b	CLIP-seq
MIRT812734	hsa-miR-17	CLIP-seq
MIRT2179199	hsa-miR-186	CLIP-seq
MIRT812735	hsa-miR-20a	CLIP-seq
MIRT812736	hsa-miR-20b	CLIP-seq
MIRT1556014	hsa-miR-301a	CLIP-seq
MIRT1556015	hsa-miR-301b	CLIP-seq
MIRT2435604	hsa-miR-3123	CLIP-seq
MIRT2179200	hsa-miR-3143	CLIP-seq
MIRT812737	hsa-miR-3190	CLIP-seq
MIRT1940285	hsa-miR-3194-5p	CLIP-seq
MIRT2426576	hsa-miR-323b-3p	CLIP-seq
MIRT2179201	hsa-miR-340	CLIP-seq
MIRT812738	hsa-miR-361-3p	CLIP-seq
MIRT812739	hsa-miR-3653	CLIP-seq
MIRT1556016	hsa-miR-3666	CLIP-seq
MIRT2384699	hsa-miR-3671	CLIP-seq
MIRT812740	hsa-miR-3673	CLIP-seq
MIRT812741	hsa-miR-3679-3p	CLIP-seq
MIRT2426577	hsa-miR-380	CLIP-seq
MIRT2435605	hsa-miR-382	CLIP-seq
MIRT1940286	hsa-miR-3972	CLIP-seq
MIRT2384700	hsa-miR-4256	CLIP-seq
MIRT2426578	hsa-miR-4275	CLIP-seq
MIRT2435606	hsa-miR-4286	CLIP-seq
MIRT1940287	hsa-miR-4290	CLIP-seq
MIRT1556017	hsa-miR-4295	CLIP-seq
MIRT1940288	hsa-miR-4330	CLIP-seq
MIRT2426579	hsa-miR-4421	CLIP-seq
MIRT812742	hsa-miR-4446-5p	CLIP-seq
MIRT2426581	hsa-miR-4528	CLIP-seq
MIRT1556018	hsa-miR-454	CLIP-seq
MIRT1556019	hsa-miR-4658	CLIP-seq
MIRT1940289	hsa-miR-4667-3p	CLIP-seq
MIRT1940290	hsa-miR-4687-5p	CLIP-seq
MIRT1556020	hsa-miR-4696	CLIP-seq
MIRT2426582	hsa-miR-4698	CLIP-seq
MIRT2384701	hsa-miR-4709-3p	CLIP-seq
MIRT2179202	hsa-miR-4716-5p	CLIP-seq
MIRT812743	hsa-miR-4752	CLIP-seq
MIRT1556021	hsa-miR-4758-5p	CLIP-seq
MIRT812744	hsa-miR-4760-3p	CLIP-seq
MIRT2384702	hsa-miR-4762-5p	CLIP-seq
MIRT2426583	hsa-miR-4781-3p	CLIP-seq
MIRT2426584	hsa-miR-4795-3p	CLIP-seq
MIRT812745	hsa-miR-4799-5p	CLIP-seq
MIRT2426585	hsa-miR-495	CLIP-seq
MIRT1940291	hsa-miR-499-3p	CLIP-seq
MIRT1940292	hsa-miR-499a-3p	CLIP-seq
MIRT2426586	hsa-miR-500a	CLIP-seq
MIRT812746	hsa-miR-513a-3p	CLIP-seq
MIRT812747	hsa-miR-519d	CLIP-seq
MIRT2179203	hsa-miR-520g	CLIP-seq
MIRT812748	hsa-miR-532-5p	CLIP-seq
MIRT2179204	hsa-miR-543	CLIP-seq
MIRT812749	hsa-miR-548ah	CLIP-seq
MIRT812750	hsa-miR-576-5p	CLIP-seq
MIRT2384703	hsa-miR-607	CLIP-seq
MIRT2426587	hsa-miR-664	CLIP-seq
MIRT1940293	hsa-miR-767-3p	CLIP-seq
MIRT2179205	hsa-miR-888	CLIP-seq
MIRT812751	hsa-miR-93	CLIP-seq
MIRT812730	hsa-miR-105	CLIP-seq
MIRT812731	hsa-miR-106a	CLIP-seq
MIRT812732	hsa-miR-106b	CLIP-seq
MIRT1940284	hsa-miR-1202	CLIP-seq
MIRT2435603	hsa-miR-1224-3p	CLIP-seq
MIRT2426574	hsa-miR-1261	CLIP-seq
MIRT2426575	hsa-miR-1298	CLIP-seq
MIRT1556012	hsa-miR-130a	CLIP-seq
MIRT1556013	hsa-miR-130b	CLIP-seq
MIRT812734	hsa-miR-17	CLIP-seq
MIRT2179199	hsa-miR-186	CLIP-seq
MIRT812735	hsa-miR-20a	CLIP-seq
MIRT812736	hsa-miR-20b	CLIP-seq
MIRT1556014	hsa-miR-301a	CLIP-seq
MIRT1556015	hsa-miR-301b	CLIP-seq
MIRT2435604	hsa-miR-3123	CLIP-seq
MIRT2179200	hsa-miR-3143	CLIP-seq
MIRT1940285	hsa-miR-3194-5p	CLIP-seq
MIRT2426576	hsa-miR-323b-3p	CLIP-seq
MIRT2179201	hsa-miR-340	CLIP-seq
MIRT812738	hsa-miR-361-3p	CLIP-seq
MIRT812739	hsa-miR-3653	CLIP-seq
MIRT1556016	hsa-miR-3666	CLIP-seq
MIRT2384699	hsa-miR-3671	CLIP-seq
MIRT812740	hsa-miR-3673	CLIP-seq
MIRT812741	hsa-miR-3679-3p	CLIP-seq
MIRT2426577	hsa-miR-380	CLIP-seq
MIRT2435605	hsa-miR-382	CLIP-seq
MIRT1940286	hsa-miR-3972	CLIP-seq
MIRT2384700	hsa-miR-4256	CLIP-seq
MIRT2426578	hsa-miR-4275	CLIP-seq
MIRT2435606	hsa-miR-4286	CLIP-seq
MIRT1940287	hsa-miR-4290	CLIP-seq
MIRT1556017	hsa-miR-4295	CLIP-seq
MIRT1940288	hsa-miR-4330	CLIP-seq
MIRT2426579	hsa-miR-4421	CLIP-seq
MIRT812742	hsa-miR-4446-5p	CLIP-seq
MIRT2426580	hsa-miR-4517	CLIP-seq
MIRT2426581	hsa-miR-4528	CLIP-seq
MIRT1556018	hsa-miR-454	CLIP-seq
MIRT1556019	hsa-miR-4658	CLIP-seq
MIRT1940289	hsa-miR-4667-3p	CLIP-seq
MIRT1940290	hsa-miR-4687-5p	CLIP-seq
MIRT1556020	hsa-miR-4696	CLIP-seq
MIRT2426582	hsa-miR-4698	CLIP-seq
MIRT2384701	hsa-miR-4709-3p	CLIP-seq
MIRT2179202	hsa-miR-4716-5p	CLIP-seq
MIRT1556021	hsa-miR-4758-5p	CLIP-seq
MIRT812744	hsa-miR-4760-3p	CLIP-seq
MIRT2384702	hsa-miR-4762-5p	CLIP-seq
MIRT2426583	hsa-miR-4781-3p	CLIP-seq
MIRT2426584	hsa-miR-4795-3p	CLIP-seq
MIRT812745	hsa-miR-4799-5p	CLIP-seq
MIRT2426585	hsa-miR-495	CLIP-seq
MIRT1940291	hsa-miR-499-3p	CLIP-seq
MIRT1940292	hsa-miR-499a-3p	CLIP-seq
MIRT2426586	hsa-miR-500a	CLIP-seq
MIRT812746	hsa-miR-513a-3p	CLIP-seq
MIRT812747	hsa-miR-519d	CLIP-seq
MIRT2179203	hsa-miR-520g	CLIP-seq
MIRT812748	hsa-miR-532-5p	CLIP-seq
MIRT2179204	hsa-miR-543	CLIP-seq
MIRT812749	hsa-miR-548ah	CLIP-seq
MIRT812750	hsa-miR-576-5p	CLIP-seq
MIRT2384703	hsa-miR-607	CLIP-seq
MIRT2426587	hsa-miR-664	CLIP-seq
MIRT1940293	hsa-miR-767-3p	CLIP-seq
MIRT2179205	hsa-miR-888	CLIP-seq
MIRT812751	hsa-miR-93	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
NFKB1	Activation	12480693
USF1	Activation	12480693
USF2	Activation	12480693

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	TAS
GO:0001913	Process	T cell mediated cytotoxicity	IEA
GO:0001916	Process	Positive regulation of T cell mediated cytotoxicity	IEA
GO:0002237	Process	Response to molecule of bacterial origin	IEA
GO:0002376	Process	Immune system process	IEA
GO:0002474	Process	Antigen processing and presentation of peptide antigen via MHC class I	IEA
GO:0002481	Process	Antigen processing and presentation of exogenous protein antigen via MHC class Ib, TAP-dependent	IEA
GO:0002502	Process	Peptide antigen assembly with MHC class I protein complex	IDA	36104323
GO:0002503	Process	Peptide antigen assembly with MHC class II protein complex	IBA
GO:0002726	Process	Positive regulation of T cell cytokine production	IDA	24643698
GO:0003254	Process	Regulation of membrane depolarization	IDA	23144825
GO:0005198	Function	Structural molecule activity	IDA	36104323
GO:0005515	Function	Protein binding	IPI	9427624, 9465039, 9546397, 9990067, 12118248, 12833155, 14764708, 15723809, 15965644, 18802093, 20164429, 20618438, 23051753, 23527218, 26030842, 27043408, 28514442, 32814053, 33961781
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	HDA	16502470, 22664934
GO:0005765	Component	Lysosomal membrane	IBA
GO:0005783	Component	Endoplasmic reticulum	IC	36104323
GO:0005788	Component	Endoplasmic reticulum lumen	TAS
GO:0005794	Component	Golgi apparatus	IDA
GO:0005829	Component	Cytosol	IDA
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	TAS
GO:0005925	Component	Focal adhesion	HDA	21423176
GO:0006826	Process	Iron ion transport	IEA
GO:0006879	Process	Intracellular iron ion homeostasis	IDA	18353247
GO:0006955	Process	Immune response	IEA
GO:0007608	Process	Sensory perception of smell	IEA
GO:0007611	Process	Learning or memory	IDA	26147761
GO:0007611	Process	Learning or memory	IEA
GO:0007611	Process	Learning or memory	ISS
GO:0009897	Component	External side of plasma membrane	IEA
GO:0009986	Component	Cell surface	IEA
GO:0010038	Process	Response to metal ion	IEA
GO:0010977	Process	Negative regulation of neuron projection development	IEA
GO:0012507	Component	ER to Golgi transport vesicle membrane	TAS
GO:0016020	Component	Membrane	HDA	19946888
GO:0019731	Process	Antibacterial humoral response	IDA	23144825
GO:0019885	Process	Antigen processing and presentation of endogenous peptide antigen via MHC class I	IGI	24643698
GO:0019886	Process	Antigen processing and presentation of exogenous peptide antigen via MHC class II	IBA
GO:0023026	Function	MHC class II protein complex binding	IBA
GO:0030670	Component	Phagocytic vesicle membrane	TAS
GO:0031901	Component	Early endosome membrane	TAS
GO:0031902	Component	Late endosome membrane	IBA
GO:0031905	Component	Early endosome lumen	TAS
GO:0033077	Process	T cell differentiation in thymus	IEA
GO:0033572	Process	Transferrin transport	IDA	18353247
GO:0034756	Process	Regulation of iron ion transport	IGI	18353247
GO:0034757	Process	Negative regulation of iron ion transport	IDA	9465039
GO:0035580	Component	Specific granule lumen	TAS
GO:0042026	Process	Protein refolding	IEA
GO:0042605	Function	Peptide antigen binding	IBA
GO:0042612	Component	MHC class I protein complex	IEA
GO:0042612	Component	MHC class I protein complex	NAS	26248266
GO:0042612	Component	MHC class I protein complex	TAS	28213472
GO:0042613	Component	MHC class II protein complex	IBA
GO:0042802	Function	Identical protein binding	IPI	17108084, 18579777, 19172750, 19564620, 20826442, 21131979, 21220305, 21569201, 22289140, 22575645
GO:0042803	Function	Protein homodimerization activity	IPI	28468825
GO:0042824	Component	MHC class I peptide loading complex	IDA	21263072, 36104323
GO:0045087	Process	Innate immune response	IDA	23144825
GO:0045646	Process	Regulation of erythrocyte differentiation	IEA
GO:0048260	Process	Positive regulation of receptor-mediated endocytosis	IGI	18353247
GO:0048261	Process	Negative regulation of receptor-mediated endocytosis	IDA	9465039
GO:0050680	Process	Negative regulation of epithelial cell proliferation	IDA	28213472
GO:0050768	Process	Negative regulation of neurogenesis	IDA	26147761
GO:0050768	Process	Negative regulation of neurogenesis	IEA
GO:0050778	Process	Positive regulation of immune response	IBA
GO:0050829	Process	Defense response to Gram-negative bacterium	IDA	23144825
GO:0050830	Process	Defense response to Gram-positive bacterium	IDA	23144825
GO:0050870	Process	Positive regulation of T cell activation	IBA
GO:0051289	Process	Protein homotetramerization	IPI	28468825
GO:0055038	Component	Recycling endosome membrane	TAS
GO:0060586	Process	Multicellular organismal-level iron ion homeostasis	IEA
GO:0061844	Process	Antimicrobial humoral immune response mediated by antimicrobial peptide	IDA	23144825
GO:0070062	Component	Extracellular exosome	HDA	19056867, 19199708, 23533145
GO:0071222	Process	Cellular response to lipopolysaccharide	IDA	23144825
GO:0071281	Process	Cellular response to iron ion	IGI	18353247
GO:0071283	Process	Cellular response to iron(III) ion	IEA
GO:0071316	Process	Cellular response to nicotine	IMP	28213472
GO:1904724	Component	Tertiary granule lumen	TAS
GO:1990000	Process	Amyloid fibril formation	IDA	28468825
GO:1990712	Component	HFE-transferrin receptor complex	IDA	9990067
GO:2000774	Process	Positive regulation of cellular senescence	IDA	28213472
GO:2000978	Process	Negative regulation of forebrain neuron differentiation	IDA	26147761
GO:2000978	Process	Negative regulation of forebrain neuron differentiation	IEA

Other IDs

• MIM: 109700
• HGNC: 914
• e!Ensembl: ENSG00000166710

Protein

• UniProt ID: P61769
• Protein name: Beta-2-microglobulin [Cleaved into: Beta-2-microglobulin form pI 5.3]
• Protein function: Component of the class I major histocompatibility complex (MHC). Involved in the presentation of peptide antigens to the immune system. Exogenously applied M.tuberculosis EsxA or EsxA-EsxB (or EsxA expressed in host) binds B2M and decreases its
• PDB: 1A1M, 1A1N, 1A1O, 1A6Z, 1A9B, 1A9E, 1AGB, 1AGC, 1AGD, 1AGE, 1AGF, 1AKJ, 1AO7, 1B0G, 1B0R, 1BD2, 1C16, 1CE6, 1CG9, 1DE4, 1DUY, 1DUZ, 1E27, 1E28, 1EEY, 1EEZ, 1EFX, 1EXU, 1GZP, 1GZQ, 1HHG, 1HHH, 1HHI, 1HHJ, 1HHK, 1HLA, 1HSA, 1HSB, 1I1F, 1I1Y, 1I4F, 1I7R, 1I7T, 1I7U, 1IM3, 1IM9, 1JF1, 1JGD, 1JGE, 1JHT, 1JNJ
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF07654	C1-set	27 → 107	Immunoglobulin C1-set domain	Domain

• Sequence:

  MSRSVALAVLALLSLSGLEAIQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLL
  KNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRDM

• Sequence length: 119

Pathways

KEGG:

Antigen processing and presentation
Human cytomegalovirus infection
Human T-cell leukemia virus 1 infection
Herpes simplex virus 1 infection
Epstein-Barr virus infection
Human immunodeficiency virus 1 infection

Reactome:

ER-Phagosome pathway
Endosomal/Vacuolar pathway
Nef mediated downregulation of MHC class I complex cell surface expression
Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
DAP12 interactions
DAP12 signaling
Neutrophil degranulation
Interferon gamma signaling
Modulation by Mtb of host immune system
Amyloid fiber formation
Antigen Presentation: Folding, assembly and peptide loading of class I MHC

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Amyloidosis, hereditary systemic 6	Likely pathogenic	rs1057519879	RCV005009638	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Familial visceral amyloidosis, Ostertag type	Likely pathogenic; Pathogenic	rs863225287, rs398122820	RCV002478720 RCV000024598	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Hypoproteinemia, hypercatabolic	Likely pathogenic	rs863225287, rs1057519879	RCV000201934 RCV005009638	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Non-Hodgkin lymphoma	Pathogenic	rs398122820	RCV000989305	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
AMYLOIDOSIS, FAMILIAL VISCERAL	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANKYLOSING SPONDYLITIS AND OTHER INFLAMMATORY SPONDYLOPATHIES	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ARTHRITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE DISEASES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOSOMAL DOMINANT BETA2-MICROGLOBULINIC AMYLOIDOSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
B2M-related condition	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BARE LYMPHOCYTE SYNDROME, TYPE I	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL SQUAMOUS CELL CARCINOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FAMILIAL VISCERAL AMYLOIDOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART DISEASES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERGAMMAGLOBULINEMIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IMMUNODEFICIENCY 43	—	HPO	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASES	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY DISEASES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY FAILURE, ACUTE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY FAILURE, CHRONIC	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LYMPHOMA, LARGE B-CELL, DIFFUSE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant lymphoma, large B-cell, diffuse	-	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neoplasm	-	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	-	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROTEINURIA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VARIANT ABETA2M AMYLOIDOSIS	—	GWAS catalog, Orphanet GWAS catalog, Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute Coronary Syndrome	Coronary Syndrome	BEFREE	29573958		★☆☆☆☆ Found in Text Mining only
Acute intermittent porphyria	Intermittent Porphyria	BEFREE	30826634		★☆☆☆☆ Found in Text Mining only
Acute Kidney Insufficiency	Acute Kidney Insufficiency	CTD_human_DG	22005293, 2689182, 28885000		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	6296550		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	CLINVAR_DG	26619011		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	24135907, 28616688		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	30161158, 8737931		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	6296550		★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	22137796, 27238634, 31782146		★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	21453388, 29297942, 30630986		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	32989152	Associate	★☆☆☆☆ Found in Text Mining only
Amyloid Neuropathies, Familial	AMYLOID CARDIOMYOPATHY	BEFREE	30161158, 8737931		★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	Pubtator	11231354, 11318968, 11849381, 12958308, 14675065, 15100226, 16901902, 17242436, 20028983, 20506535, 22895515, 24014031, 24336936, 25803608, 27150430, 29455155, 30375379, 31167508, 31416179, 31527472, 31552823, 32661194, 33253560, 36328246, 36864041, 8113390, 8887286, 9987081	Associate	★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	11318968, 19657763, 22566695, 22683352, 22693999, 24336936, 25803608, 27467899, 28468825, 28745031, 29161700, 29268797, 29896815, 30223436, 30707483, 30991407, 31420997, 31711963, 8737931, 9350687		★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	LHGDN	12968074, 16122756		★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	Pubtator	35615856	Stimulate	★☆☆☆☆ Found in Text Mining only
Amyloidosis Familial	Amyloidosis	Pubtator	24014031, 27380955, 29455155, 31416179, 35613051	Associate	★☆☆☆☆ Found in Text Mining only
Amyloidosis, familial visceral	Amyloidosis	GENOMICS_ENGLAND_DG	22693999		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Amyloidosis, familial visceral	Amyloidosis	UNIPROT_DG	22693999		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Amyloidosis, familial visceral	Amyloidosis	CLINVAR_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Amyloidosis, familial visceral	Amyloidosis	CTD_human_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AMYLOIDOSIS, HEREDITARY, TRANSTHYRETIN-RELATED	Amyloidosis	BEFREE	30161158, 8737931		★☆☆☆☆ Found in Text Mining only
Amyotrophic lateral sclerosis 1	Amyotrophic lateral sclerosis	Pubtator	23006766	Associate	★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	16313263, 24828862		★☆☆☆☆ Found in Text Mining only
Anodontia	Anodontia	Pubtator	22353804	Associate	★☆☆☆☆ Found in Text Mining only
Antiphospholipid Syndrome	Antiphospholipid Syndrome	BEFREE	30420561		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	29795686		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	29795686		★☆☆☆☆ Found in Text Mining only
Aplastic Anemia	Aplastic anemia	BEFREE	12601489		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	27645611, 28535187, 29954284		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	19897967, 30770760, 8228809		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Arthritis	Arthritis	Pubtator	30770760	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	12531797, 8608632	Associate	★☆☆☆☆ Found in Text Mining only
Arthropathy	Arthropathy	BEFREE	11318968, 30243785		★☆☆☆☆ Found in Text Mining only
Asphyxia Neonatorum	Postnatal asphyxia	BEFREE	31536999		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	2293915		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	27645611, 28535187, 29954284		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	17214095		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autoimmune Diseases	Autoimmune Diseases	CTD_human_DG	21793797		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autonomic bladder dysfunction	Dysautonomia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Autosomal dominant beta2-microglobulinic amyloidosis	Variant ABeta2M amyloidosis	ORPHANET_DG	22693999		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
B-Cell Lymphomas	B-Cell Lymphoma	LHGDN	12471623		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	8467805		★☆☆☆☆ Found in Text Mining only
Bare Lymphocyte Syndrome	Bare Lymphocyte Syndrome	BEFREE	3894422, 6162064		★☆☆☆☆ Found in Text Mining only
Bare lymphocyte syndrome 2	Bare Lymphocyte Syndrome	BEFREE	3894422, 6162064		★☆☆☆☆ Found in Text Mining only
Bare Lymphocyte Syndrome, Type I	Bare Lymphocyte Syndrome	ORPHANET_DG	25702838		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
beta Thalassemia	beta Thalassemia	BEFREE	6426239		★☆☆☆☆ Found in Text Mining only
beta^+^ Thalassemia	beta Thalassemia	BEFREE	6426239		★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone Disease	BEFREE	28034989		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	11182222, 25292288, 30866857, 9709006		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	22355776, 25292288, 30327465, 30866857, 34752497	Associate	★☆☆☆☆ Found in Text Mining only
Bronchiectasis	Bronchiectasis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	12142034		★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	19265139	Associate	★☆☆☆☆ Found in Text Mining only
Cakut	Congenital anomalies of kidney and urinary tract	BEFREE	29727865		★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	22211248, 26983758	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	16399877		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	15526362, 19036168	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	28302866, 8824545		★☆☆☆☆ Found in Text Mining only
Carcinoma Small Cell	Small cell carcinoma	Pubtator	34911496	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	24457517, 30810435	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	22258792, 26983758		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	23417110, 28249620	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	28249620, 30072448, 31086050, 31257404		★☆☆☆☆ Found in Text Mining only
Carpal Tunnel Syndrome	Carpal Tunnel Syndrome	LHGDN	18257814		★☆☆☆☆ Found in Text Mining only
Carpal Tunnel Syndrome	Carpal Tunnel Syndrome	BEFREE	29161700, 8643171, 9350687		★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Cartilage disease	Pubtator	12464555	Associate	★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	6296550		★☆☆☆☆ Found in Text Mining only
Cholestasis	Cholestasis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	2104910, 2254882		★☆☆☆☆ Found in Text Mining only
Chronic axonal neuropathy	Neuropathy	HPO_DG			★☆☆☆☆ Found in Text Mining only
Chronic heart failure	Heart Failure	BEFREE	30072448		★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	28535187, 28664159, 29896815, 30320415, 30678941, 9350687		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	27645611, 28664159, 28939943, 28962501, 31257404, 9350687		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	16551975, 20425388, 22145958, 24551294, 26219471, 26588193, 28370385		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	28213472	Stimulate	★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	10723676		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	14652292, 1737380, 22353804, 2642530		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	LHGDN	18695889		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	1912516		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	18506145, 21874254, 22859396, 28616688, 30503610, 31062389		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	17373663		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	18695889, 20122155, 22072317, 22353804, 24383454, 28616688, 29510987, 31062389, 32424999, 33159376, 35343934, 36724040, 38256174, 8552612	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	CLINVAR_DG	26619011		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms Hereditary Nonpolyposis	Lynch syndrome	Pubtator	28616688, 31358939	Associate	★☆☆☆☆ Found in Text Mining only
Combined immunodeficiency	Severe combined immunodeficiency disease	BEFREE	6162064		★☆☆☆☆ Found in Text Mining only
Cone-Rod Dystrophy 2	Cone-rod dystrophy	BEFREE	22335434		★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	12802910, 15359986, 17296972, 21208658, 22508408, 26219471, 27742074, 30056581, 7828155		★☆☆☆☆ Found in Text Mining only
Congenital posterior urethral valves	Congenital Posterior Urethral Valves	BEFREE	30207389		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	30072448		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	14713847, 1606987, 17189401, 8187375		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	28249620		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	28249620		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	28249620	Stimulate	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	28249620, 31605509		★☆☆☆☆ Found in Text Mining only
Coronary Stenosis	Coronary Stenosis	BEFREE	29573958		★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	CLINVAR_DG	26619011		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	12464555		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	LHGDN	12480959		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	29795686		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	27160934, 27173460, 28535187, 28971590, 29573958		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	27160934, 27173460, 28535187, 28971590, 29573958		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	35504843	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	27173460, 30311395		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	LHGDN	12738401		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	28236320, 31813771		★☆☆☆☆ Found in Text Mining only
Diabetes, Autoimmune	Autoimmune Diabetes	BEFREE	1763324		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	36277688	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	27173460, 28236320, 28390099, 29507271, 30982743		★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	12471623, 22137796, 27238634, 29051524, 31782146		★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	CTD_human_DG	7688627		★☆☆☆☆ Found in Text Mining only
Emphysema	Emphysema	Pubtator	28213472	Stimulate	★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	BEFREE	31764808		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	36724040	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Stromal Sarcoma	Endometrial Stromal Sarcoma	BEFREE	31013508		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	11163839		★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	22258792		★☆☆☆☆ Found in Text Mining only
Ewings sarcoma-primitive neuroectodermal tumor (PNET)	Ewing sarcoma	BEFREE	7571088, 8375858		★☆☆☆☆ Found in Text Mining only
Fecal Incontinence	Bowel incontinence	HPO_DG			★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	28548299		★☆☆☆☆ Found in Text Mining only
Focal glomerulosclerosis	Glomerulosclerosis	BEFREE	27173460		★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	25311765		★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	CLINVAR_DG	26619011		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	40071076	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	33658560	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	33960680	Stimulate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	Pubtator	33754492	Associate	★☆☆☆☆ Found in Text Mining only
Harlequin Fetus	Harlequin Ichthyosis	BEFREE	26980598		★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head And Neck Neoplasms	BEFREE	28891951		★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	CTD_human_DG	16844662		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart Failure	Heart failure	Pubtator	33467687	Associate	★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	12531797	Associate	★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	17045207, 31834655		★☆☆☆☆ Found in Text Mining only
Hemochromatosis	Hemochromatosis	BEFREE	23874600, 9723005		★☆☆☆☆ Found in Text Mining only
Hemochromatosis	Hemochromatosis	Pubtator	28213472	Associate	★☆☆☆☆ Found in Text Mining only
HEMOCHROMATOSIS, TYPE 1	Hemochromatosis	BEFREE	23874600, 9723005		★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	10651797	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary hemochromatosis	Hereditary Hemochromatosis	BEFREE	19059216, 8920884		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	25488972, 30108156, 31697821, 31816062, 32079702, 36723991	Associate	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	27737878	Inhibit	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	29896815		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	29896815		★☆☆☆☆ Found in Text Mining only
Hypergammaglobulinemia	Hypergammaglobulinemia	CTD_human_DG	21793797		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypernatriuria	Hypernatriuria	BEFREE	31699212		★☆☆☆☆ Found in Text Mining only
Hyperproteinemia	Hyperproteinemia	BEFREE	31355076		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	30072448, 30288264		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	HPO_DG			★☆☆☆☆ Found in Text Mining only
hypertensive nephropathy	Hypertensive Nephropathy	BEFREE	30671127, 30906478		★☆☆☆☆ Found in Text Mining only
Hyperuricemia	Hyperuricemia	BEFREE	29635733		★☆☆☆☆ Found in Text Mining only
Hypoalbuminemia	Hypoalbuminemia	BEFREE	16313263		★☆☆☆☆ Found in Text Mining only
Hypoalbuminemia	Hypoalbuminemia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hypoproteinemia	Hypoproteinemia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hypoproteinemia, Hypercatabolic	Hypoproteinemia, Hypercatabolic	BEFREE	16549777		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Hypoproteinemia, Hypercatabolic	Hypoproteinemia, Hypercatabolic	UNIPROT_DG	16549777		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Hypoproteinemia, Hypercatabolic	Hypoproteinemia, Hypercatabolic	GENOMICS_ENGLAND_DG	25702838		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Hypoproteinemia, Hypercatabolic	Hypoproteinemia, Hypercatabolic	CLINVAR_DG			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Hypoproteinemia, Hypercatabolic	Hypoproteinemia, Hypercatabolic	CTD_human_DG			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Hypoxia	Hypoxia	Pubtator	34035373	Associate	★☆☆☆☆ Found in Text Mining only
Immunodeficiency by defective expression of MHC class I	Bare Lymphocyte Syndrome	Orphanet			★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	28240096, 28611236, 29620245, 31708756		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	29571746, 32424999	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Intestinal Diseases	Intestinal Diseases	BEFREE	29571746		★☆☆☆☆ Found in Text Mining only
Iron Overload	Iron Overload	BEFREE	19059216, 23874600, 8920884		★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	31053801		★☆☆☆☆ Found in Text Mining only
Ischemic Stroke	Ischemic stroke	Pubtator	31053801	Stimulate	★☆☆☆☆ Found in Text Mining only
Keratoconjunctivitis Sicca	Keratoconjunctivitis Sicca	HPO_DG			★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	1543671, 27173460, 28664159, 29486722, 30024955, 30524714, 30826634, 31663630		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Diseases	Kidney Disease	CTD_human_DG	17303580, 2202081, 24863737		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Diseases	Kidney disease	Pubtator	36328246	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Diseases	Kidney Disease	HPO_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Failure	Kidney Failure	BEFREE	19657763, 28168880, 28257169, 29896815		★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	14675065	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	CTD_human_DG	22005293, 2689182, 28885000		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Failure, Acute	Kidney Failure	BEFREE	28962501, 30223436, 30524714, 31296157, 31345164		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Failure, Chronic	Kidney Failure	BEFREE	28535187, 28664159, 29896815, 30320415, 30659825, 30678941, 9350687		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	31173291	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	25292288	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	30503610, 6278187, 8477061		★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	33284559	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	LHGDN	18245532		★☆☆☆☆ Found in Text Mining only
Li-Fraumeni Syndrome	Li-Fraumeni Syndrome	BEFREE	15526362		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	30220970		★☆☆☆☆ Found in Text Mining only
Liver Diseases Alcoholic	Liver disease	Pubtator	36582223	Associate	★☆☆☆☆ Found in Text Mining only
Liver Neoplasms	Liver neoplasm	Pubtator	34752497	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	20649604, 29025772, 2983911	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	22577117, 29533541, 29954284, 30813870, 6153898		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	29451067		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	1718386	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	18506145	Inhibit	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	38256174	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphohistiocytosis Hemophagocytic	Hemophagocytic lymphohistiocytosis	Pubtator	27110054	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	10569136, 11172955, 29297942, 31156054		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	25991819, 33311649	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	26752561	Inhibit	★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	25488972, 27959929, 37493986	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	BEFREE	10707796		★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	LHGDN	18024396		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	27238634		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	CLINVAR_DG	26619011		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	BEFREE	27238634		★☆☆☆☆ Found in Text Mining only
Lymphomatoid Papulosis	Lymphomatoid Papulosis	BEFREE	29171395		★☆☆☆☆ Found in Text Mining only
Malabsorption Syndrome	Malabsorption Syndrome	HPO_DG			★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	11182222, 25292288, 30866857, 8824545, 9709006		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	25311765		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	1423266, 23874600		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	28302866, 8824545		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	26983758		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	17404077		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	20564426, 23874600, 25527621		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	31620857		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	20507635, 22134332, 23874600, 24971583, 26278164, 26983758, 29320758, 30810435, 6175458, 8375858		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	14652292, 1737380, 22353804		★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	BEFREE	30297628		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	30145665		★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	29246179, 31348229		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	19594892	Associate	★☆☆☆☆ Found in Text Mining only
Megacystis microcolon intestinal hypoperistalsis syndrome	Berdon syndrome	BEFREE	29752823		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	10395107, 2293915, 28870403, 29849947, 30684558, 6179079, 7689931, 8432869		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	11260330, 15661905, 16648140, 25294904, 34035373, 8006598, 8432869, 9637706	Associate	★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	12516095, 16740750		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	29795686		★☆☆☆☆ Found in Text Mining only
Metabolic Bone Disorder	Metabolic Bone Disorder	BEFREE	28318624		★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	BEFREE	12662150		★☆☆☆☆ Found in Text Mining only
Milroy Disease	Milroy Disease	BEFREE	18676019, 9220667		★☆☆☆☆ Found in Text Mining only
Mitral Valve Stenosis	Mitral Valve Stenosis	BEFREE	30196829		★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	18841160	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	10520002, 14581276, 17644731, 22352188, 26545722, 26877783, 26990223, 29571746, 32799782, 3291982, 35372573, 36864041, 7811998	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	12139738	Inhibit	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	12531797, 16144800	Stimulate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	12592343, 12802910, 15359986, 16263571, 17045207, 17692103, 19187273, 24239198, 2451550, 24995304, 25578543, 28256461, 28978808, 29417568, 30056581, 30176173, 30890040, 31387843, 31601173, 31762076, 31784918, 8767528, 9215838		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	LHGDN	16891806, 18022010		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	CLINVAR_DG	26619011		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	22335434, 30114292, 30196829		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	16945414, 7863633		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	30702442		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	1520593, 36107539	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	15305409, 8738471		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10395107, 10569136, 11082513, 12471623, 12973027, 1588254, 20507635, 21400022, 2187600, 22833104, 22859396, 23098292, 23196330, 23874600, 24995304, 25118879, 25739076, 26285657, 28040849, 28616688, 29246179, 29297942, 29394125, 30145665, 30503610, 30630986, 30810435, 31345234, 31620857, 31762076, 31776631, 31782146, 6436814, 8187375, 8335937, 8512807		★☆☆☆☆ Found in Text Mining only
Nephritis	Nephritis	BEFREE	30813870		★☆☆☆☆ Found in Text Mining only
Nephritis, Interstitial	Nephritis	BEFREE	31086050		★☆☆☆☆ Found in Text Mining only
Nephritis, Tubulointerstitial	Nephritis	BEFREE	31086050		★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic syndrome	Pubtator	16810512	Associate	★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic Syndrome	HPO_DG			★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	30196829		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	2187600, 6436814, 7571088, 8316764, 8375858, 8550813		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	28213472	Associate	★☆☆☆☆ Found in Text Mining only
Niemann-Pick Disease, Type C	Niemann-Pick Disease	BEFREE	15305409		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	25573171, 8546899		★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	12464555	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthropathy Primary Hypertrophic	Primary hypertrophic osteoarthropathy	Pubtator	9987081	Associate	★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	31712560	Associate	★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	37874452	Stimulate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	16995877		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	26983758		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	19829086, 22258792, 34275654	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	26983758	Stimulate	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	30810435	Associate	★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	25294906		★☆☆☆☆ Found in Text Mining only
Paraproteinemias	Paraproteinemia	BEFREE	21208658		★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Disease	Peripheral arterial disease	Pubtator	18687758, 28249620	Associate	★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Diseases	Vascular Diseases	BEFREE	28249620, 28992939		★☆☆☆☆ Found in Text Mining only
Peripheral T-Cell Lymphoma	T-Cell Lymphoma	CTD_human_DG	24413734		★☆☆☆☆ Found in Text Mining only
Peripheral T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	31423206		★☆☆☆☆ Found in Text Mining only
Peripheral Vascular Diseases	Vascular Diseases	BEFREE	28249620		★☆☆☆☆ Found in Text Mining only
Phosphate Diabetes	Phosphate Diabetes	BEFREE	29932293		★☆☆☆☆ Found in Text Mining only
Polycystic Kidney Diseases	Polycystic kidney disease	BEFREE	31086050		★☆☆☆☆ Found in Text Mining only
Polycystic Kidney, Autosomal Dominant	Polycystic kidney disease	BEFREE	31600749		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	32729067	Associate	★☆☆☆☆ Found in Text Mining only
Polyneuropathy	Polyneuropathy	BEFREE	8187375		★☆☆☆☆ Found in Text Mining only
Primary central nervous system lymphoma	Central Nervous System Lymphoma	BEFREE	29808930		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	20564426, 23874600, 25527621		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	17404077		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	18765525		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	18765525	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary edema of mountaineers	Pulmonary edema	Pubtator	37165489	Associate	★☆☆☆☆ Found in Text Mining only
Reactive systemic amyloidosis	Reactive Systemic Amyloidosis	BEFREE	8187375		★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	1423266, 23874600, 9127144		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	14713847, 1606987, 17189401, 7490887, 8187375, 9127144		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	LHGDN	17499801		★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	27145370, 28390099		★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	BEFREE	28249620, 28979697, 30114996		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	14983503	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	BEFREE	28806188		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	23395714		★☆☆☆☆ Found in Text Mining only
Secondary malignant neoplasm of colon and/or rectum	Colorectal Neoplasms	BEFREE	28730771, 30086420		★☆☆☆☆ Found in Text Mining only
Sensorineural Hearing Loss (disorder)	Hearing Loss	BEFREE	31699212		★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	29620245, 31063510		★☆☆☆☆ Found in Text Mining only
Serous cystadenocarcinoma ovary	Ovarian Serous Cystadenocarcinoma	CLINVAR_DG	26619011		★☆☆☆☆ Found in Text Mining only
Severe Acute Respiratory Syndrome	Severe Acute Respiratory Syndrome	BEFREE	20844028		★☆☆☆☆ Found in Text Mining only
Severe Combined Immunodeficiency	Severe combined immunodeficiency disease	BEFREE	26285657		★☆☆☆☆ Found in Text Mining only
Sicca Syndrome	Sjogren`s Syndrome	BEFREE	29465367		★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	8228809		★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	CLINVAR_DG	26619011		★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	2580935	Inhibit	★☆☆☆☆ Found in Text Mining only
Spondylarthritis	Spondyloarthritis	BEFREE	19897967		★☆☆☆☆ Found in Text Mining only
Sporadic Breast Carcinoma	Breast Carcinoma	BEFREE	12445306		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	18841160		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	CTD_human_DG	21517111		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	29615660		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	10555762, 18841160, 19650912, 22211248, 37057033	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	CLINVAR_DG	26619011		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	CLINVAR_DG	26619011		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	31620857		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	20507635, 31620857, 36724040, 39350044	Associate	★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	28410236		★☆☆☆☆ Found in Text Mining only
Turcot syndrome	Turcot syndrome	Pubtator	28616688, 36631610, 36724040	Associate	★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	14652292, 9741021		★☆☆☆☆ Found in Text Mining only
Uremia	Uremia	Pubtator	10651797	Associate	★☆☆☆☆ Found in Text Mining only
Uremia	Uremia	BEFREE	9237284		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	27835695, 35321689	Associate	★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal Melanoma	BEFREE	23196330		★☆☆☆☆ Found in Text Mining only
Variant ABeta2M amyloidosis	Variant ABeta2M Amyloidosis	Orphanet			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Vascular Calcification	Vascular calcification	Pubtator	22895515	Associate	★☆☆☆☆ Found in Text Mining only
Ventricular Fibrillation	Ventricular fibrillation	Pubtator	20028983	Associate	★☆☆☆☆ Found in Text Mining only
Vitamin D Deficiency	Vitamin d deficiency	Pubtator	29216383	Associate	★☆☆☆☆ Found in Text Mining only
X-linked myopathy with excessive autophagy	Myopathy With Excessive Autophagy, X-Linked	BEFREE	23850239		★☆☆☆☆ Found in Text Mining only