Gene Gene information from NCBI Gene database.
Entrez ID 56683
Gene name Cilia and flagella associated protein 298
Gene symbol CFAP298
Synonyms (NCBI Gene)
C21orf48C21orf59CILD26DNAAF16FBB18Kur
Chromosome 21
Chromosome location 21q22.11
Summary This gene encodes a protein that plays a critical role in dynein arm assembly and motile cilia function. Mutations in this gene result in primary ciliary dyskinesia. Naturally occuring readthrough transcription occurs from this locus to the downstream t-c
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
16
GO ID Ontology Definition Evidence Reference
GO:0003352 Process Regulation of cilium movement IEA
GO:0003352 Process Regulation of cilium movement IGI 24094744
GO:0003352 Process Regulation of cilium movement IMP 24094744
GO:0005515 Function Protein binding IPI 28514442, 29601588, 33961781
GO:0005634 Component Nucleus HDA 16780588
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
615494 1301 ENSG00000159079
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P57076
Protein name Cilia- and flagella-associated protein 298 (Protein kurly homolog)
Protein function Plays a role in motile cilium function, possibly by acting on outer dynein arm assembly (PubMed:24094744). Seems to be important for initiation rather than maintenance of cilium motility (By similarity). Required for correct positioning of the c
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF11069 CFAP298 189 285 Cilia- and flagella-associated protein 298 Family
Sequence
MVLLHVKRGDESQFLLQAPGSTELEELTVQVARVYNGRLKVQRLCSEMEELAEHGIFLPP
NMQGLTDDQIEELKLKDEWGEKCVPSGGAVFKKDDIGRRNGQAPNEKMKQVLKKTIEEAK
AIISKKQVEAGVCVTMEMVKDALDQLRGAVMIVYPMGLPPYDPIRMEFENKEDLSGTQAG
LNVIKEAEAQLWWAAKELRRTKKLSDYVGKNEKTKIIAKIQQRGQGAPAREPIISSEEQK
QLMLYYHRRQEELKRLEENDDDAYLNSPWADNTALKRHFHGVKDI
KWRPR
Sequence length 290
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
16
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession Evidence Score
Heterotaxy Pathogenic rs2146563694 RCV001732152
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Primary ciliary dyskinesia 26 Likely pathogenic; Pathogenic rs202094637, rs750995181, rs746361802, rs2038760864, rs143740376, rs398122401 RCV000074371
RCV003138417
RCV001078454
RCV001078453
RCV000074372
View all (1 more)
★★★★★
ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
Acute myeloid leukemia Benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Cervical cancer Benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
CFAP298-related disorder Likely benign; Benign; Uncertain significance ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
CILIARY DYSKINESIA, PRIMARY, 26 CTD, Disgenet, HPO
CTD, Disgenet, HPO
CTD, Disgenet, HPO
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Asthenozoospermia Asthenozoospermia HPO_DG
★☆☆☆☆
Found in Text Mining only
Asthma Asthma HPO_DG
★☆☆☆☆
Found in Text Mining only
Bronchiectasis Bronchiectasis HPO_DG
★☆☆☆☆
Found in Text Mining only
Bronchitis, Chronic Gastric Cancer HPO_DG
★☆☆☆☆
Found in Text Mining only
Chronic Kidney Diseases Kidney Disease BEFREE 28410202
★☆☆☆☆
Found in Text Mining only
Chronic otitis media Otitis media HPO_DG
★☆☆☆☆
Found in Text Mining only
Chronic sinusitis Sinusitis HPO_DG
★☆☆☆☆
Found in Text Mining only
Ciliary Dyskinesia, Primary, 1, With Or Without Situs Inversus Ciliary Dyskinesia ORPHANET_DG 24094744
★☆☆☆☆
Found in Text Mining only
Ciliary Dyskinesia, Primary, 1, With Or Without Situs Inversus Ciliary Dyskinesia CLINVAR_DG
★☆☆☆☆
Found in Text Mining only
CILIARY DYSKINESIA, PRIMARY, 26 Ciliary dyskinesia UNIPROT_DG 24094744
★★☆☆☆
Found in Text Mining + Unknown/Other Associations