NRIP3 (nuclear receptor interacting protein 3)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID 56675
Gene name Nuclear receptor interacting protein 3
Gene symbol NRIP3
Synonyms (NCBI Gene)
C11orf14NY-SAR-105
Chromosome 11
Chromosome location 11p15.4
miRNA miRNA information provided by mirtarbase database.
633
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all (633)
miRTarBase ID miRNA Experiments Reference
MIRT021324 hsa-miR-9-5p Microarray 17612493
MIRT611450 hsa-miR-1306-5p HITS-CLIP 23824327
MIRT611449 hsa-miR-6511a-3p HITS-CLIP 23824327
MIRT611448 hsa-miR-6511b-3p HITS-CLIP 23824327
MIRT611447 hsa-miR-6784-3p HITS-CLIP 23824327
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
3
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all (3)
GO ID Ontology Definition Evidence Reference
GO:0004190 Function Aspartic-type endopeptidase activity IEA
GO:0005515 Function Protein binding IPI 25416956, 32296183
GO:0006508 Process Proteolysis IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
613125 1167 ENSG00000175352
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9NQ35
Protein name Nuclear receptor-interacting protein 3 (Sarcoma antigen NY-SAR-105)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF09668 Asp_protease 87 → 209 Aspartyl protease Family
Sequence 
MFYSGLLTEGGRKETDMREAASLRQQRRMKQAVQFIHKDSADLLPLDGLKKLGSSKDMQP
HNILQRRLMETNLSKLRSGPRVPWASKTNKLNQAKSEGLKKSEEDDMILVSCQCAGKDVK
ALVDTGCLYNLISLACVDRLGLKEHVKSHKHEGEKLSLPRHLKVVGQIEHLVITLGSLRL
DCPAAVVDDNEKNLSLGLQTLRSLKCIINLDKHRLIMGKTDKEEIPFVETVSLNEDNTSE
A
Sequence length 241
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Show/Hide Unknown Diseases (1)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
ALZHEIMER DISEASE — GWAS catalog
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations