Gene Gene information from NCBI Gene database.
Entrez ID 56667
Gene name Mucin 13, cell surface associated
Gene symbol MUC13
Synonyms (NCBI Gene)
DRCC1MUC-13
Chromosome 3
Chromosome location 3q21.2
Summary Epithelial mucins, such as MUC13, are a family of secreted and cell surface glycoproteins expressed by ductal and glandular epithelial tissues (Williams et al., 2001 [PubMed 11278439]).[supplied by OMIM, Jul 2008]
miRNA miRNA information provided by mirtarbase database.
53
miRTarBase ID miRNA Experiments Reference
MIRT019433 hsa-miR-148b-3p Microarray 17612493
MIRT021860 hsa-miR-132-3p Microarray 17612493
MIRT022029 hsa-miR-128-3p Microarray 17612493
MIRT021860 hsa-miR-132-3p ImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot 28339011
MIRT021860 hsa-miR-132-3p ImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot 28339011
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
12
GO ID Ontology Definition Evidence Reference
GO:0005576 Component Extracellular region IEA
GO:0005615 Component Extracellular space IDA 11278439
GO:0005796 Component Golgi lumen TAS
GO:0005829 Component Cytosol IMP 11278439
GO:0005886 Component Plasma membrane IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
612181 7511 ENSG00000173702
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9H3R2
Protein name Mucin-13 (MUC-13) (Down-regulated in colon cancer 1)
Protein function Epithelial and hemopoietic transmembrane mucin that may play a role in cell signaling.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01390 SEA 214 323 SEA domain Family
Tissue specificity TISSUE SPECIFICITY: Highly expressed in epithelial tissues, particularly those of the gastrointestinal and respiratory tracts, such as large intestine and trachea, followed by kidney, small intestine, appendix and stomach. {ECO:0000269|PubMed:11278439}.
Sequence
MKAIIHLTLLALLSVNTATNQGNSADAVTTTETATSGPTVAAADTTETNFPETASTTANT
PSFPTATSPAPPIISTHSSSTIPTPAPPIISTHSSSTIPIPTAADSESTTNVNSLATSDI
ITASSPNDGLITMVPSETQSNNEMSPTTEDNQSSGPPTGTALLETSTLNSTGPSNPCQDD
PCADNSLCVKLHNTSFCLCLEGYYYNSSTCKKGKVFPGKISVTVSETFDPEEKHSMAYQD
LHSEITSLFKDVFGTSVYGQTVILTVSTSLSPRSEMRADDKFVNVTIVTILAETTSDNEK
TVTEKINKAIRSSSSNFLNYDLT
LRCDYYGCNQTADDCLNGLACDCKSDLQRPNPQSPFC
VASSLKCPDACNAQHKQCLIKKSGGAPECACVPGYQEDANGNCQKCAFGYSGLDCKDKFQ
LILTIVGTIAGIVILSMIIALIVTARSNNKTKHIEEENLIDEDFQNLKLRSTGFTNLGAE
GSVFPKVRITASRDSQMQNPYSRHSSMPRPDY
Sequence length 512
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Defective GALNT3 causes familial hyperphosphatemic tumoral calcinosis (HFTC)
Defective C1GALT1C1 causes Tn polyagglutination syndrome (TNPS)
Defective GALNT12 causes colorectal cancer 1 (CRCS1)
Dectin-2 family
O-linked glycosylation of mucins
Termination of O-glycan biosynthesis
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
NARCOLEPSY GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
ANOPHTHALMIA AND PULMONARY HYPOPLASIA Syndromic microphthalmia BEFREE 25277192, 27321183, 29352660
★☆☆☆☆
Found in Text Mining only
Carcinogenesis Carcinogenesis Pubtator 15904467, 37116131 Associate
★☆☆☆☆
Found in Text Mining only
Carcinoma Carcinoma Pubtator 26323930 Associate
★☆☆☆☆
Found in Text Mining only
Carcinoma Carcinoma BEFREE 29768245
★☆☆☆☆
Found in Text Mining only
Carcinoma Hepatocellular Hepatocellular carcinoma Pubtator 30700707 Associate
★☆☆☆☆
Found in Text Mining only
Carcinoma Pancreatic Ductal Pancreatic ductal carcinoma Pubtator 27321183, 29352660 Associate
★☆☆☆☆
Found in Text Mining only
Carcinoma Renal Cell Renal cell carcinoma Pubtator 27911274 Associate
★☆☆☆☆
Found in Text Mining only
Carcinoma, Ovarian Epithelial Ovarian Epithelial carcinoma BEFREE 19176398, 23708057, 25048476
★☆☆☆☆
Found in Text Mining only
Colitis Colitis BEFREE 28191818, 31427737
★☆☆☆☆
Found in Text Mining only
Colon Carcinoma Colon Carcinoma BEFREE 22914648, 24097071
★☆☆☆☆
Found in Text Mining only