Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	56666
Gene name	Pannexin 2
Gene symbol	PANX2
Synonyms (NCBI Gene)	PX2hPANX2
Chromosome	22
Chromosome location	22q13.33
Summary	The protein encoded by this gene belongs to the innexin family. Innexin family members are the structural components of gap junctions. This protein and pannexin 1 are abundantly expressed in central nervous system (CNS) and are coexpressed in various neur

Show/Hide all (64)

miRTarBase ID	miRNA	Experiments
MIRT1212427	hsa-let-7a	CLIP-seq
MIRT1212428	hsa-let-7b	CLIP-seq
MIRT1212429	hsa-let-7c	CLIP-seq
MIRT1212430	hsa-let-7d	CLIP-seq
MIRT1212431	hsa-let-7e	CLIP-seq
MIRT1212432	hsa-let-7f	CLIP-seq
MIRT1212433	hsa-let-7g	CLIP-seq
MIRT1212434	hsa-let-7i	CLIP-seq
MIRT1212435	hsa-miR-1273d	CLIP-seq
MIRT1212436	hsa-miR-1286	CLIP-seq
MIRT1212437	hsa-miR-136	CLIP-seq
MIRT1212438	hsa-miR-202	CLIP-seq
MIRT1212439	hsa-miR-3170	CLIP-seq
MIRT1212440	hsa-miR-329	CLIP-seq
MIRT1212441	hsa-miR-342-5p	CLIP-seq
MIRT1212442	hsa-miR-362-3p	CLIP-seq
MIRT1212443	hsa-miR-3649	CLIP-seq
MIRT1212444	hsa-miR-370	CLIP-seq
MIRT1212445	hsa-miR-377	CLIP-seq
MIRT1212446	hsa-miR-4260	CLIP-seq
MIRT1212447	hsa-miR-4458	CLIP-seq
MIRT1212448	hsa-miR-4500	CLIP-seq
MIRT1212449	hsa-miR-4508	CLIP-seq
MIRT1212450	hsa-miR-4648	CLIP-seq
MIRT1212451	hsa-miR-4651	CLIP-seq
MIRT1212452	hsa-miR-4664-5p	CLIP-seq
MIRT1212453	hsa-miR-4678	CLIP-seq
MIRT1212454	hsa-miR-4722-5p	CLIP-seq
MIRT1212455	hsa-miR-4747-5p	CLIP-seq
MIRT1212456	hsa-miR-4793-5p	CLIP-seq
MIRT1212457	hsa-miR-574-3p	CLIP-seq
MIRT1212458	hsa-miR-608	CLIP-seq
MIRT1212459	hsa-miR-767-3p	CLIP-seq
MIRT1212460	hsa-miR-98	CLIP-seq
MIRT1212435	hsa-miR-1273d	CLIP-seq
MIRT1212444	hsa-miR-370	CLIP-seq
MIRT1212456	hsa-miR-4793-5p	CLIP-seq
MIRT2289718	hsa-miR-1976	CLIP-seq
MIRT2289719	hsa-miR-3667-3p	CLIP-seq
MIRT2289720	hsa-miR-3682-3p	CLIP-seq
MIRT2289721	hsa-miR-4421	CLIP-seq
MIRT2289722	hsa-miR-4502	CLIP-seq
MIRT1212456	hsa-miR-4793-5p	CLIP-seq
MIRT2392094	hsa-miR-1224-3p	CLIP-seq
MIRT2392095	hsa-miR-1236	CLIP-seq
MIRT1212435	hsa-miR-1273d	CLIP-seq
MIRT2392096	hsa-miR-1285	CLIP-seq
MIRT2392097	hsa-miR-149	CLIP-seq
MIRT2392098	hsa-miR-3187-5p	CLIP-seq
MIRT2392099	hsa-miR-3622a-3p	CLIP-seq
MIRT2392100	hsa-miR-3622b-3p	CLIP-seq
MIRT2289719	hsa-miR-3667-3p	CLIP-seq
MIRT1212444	hsa-miR-370	CLIP-seq
MIRT2392101	hsa-miR-4292	CLIP-seq
MIRT2392102	hsa-miR-4308	CLIP-seq
MIRT2392103	hsa-miR-4505	CLIP-seq
MIRT1212456	hsa-miR-4793-5p	CLIP-seq
MIRT2392104	hsa-miR-612	CLIP-seq
MIRT2392105	hsa-miR-670	CLIP-seq
MIRT2392106	hsa-miR-760	CLIP-seq
MIRT2687053	hsa-miR-3940-3p	CLIP-seq
MIRT2687054	hsa-miR-4532	CLIP-seq
MIRT2687055	hsa-miR-4640-5p	CLIP-seq
MIRT2687056	hsa-miR-4726-5p	CLIP-seq

Show/Hide all (24)

GO ID	Ontology	Definition	Evidence
GO:0000139	Component	Golgi membrane	IEA
GO:0002931	Process	Response to ischemia	IEA
GO:0005198	Function	Structural molecule activity	ISS
GO:0005243	Function	Gap junction channel activity	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005794	Component	Golgi apparatus	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006812	Process	Monoatomic cation transport	IBA
GO:0006812	Process	Monoatomic cation transport	IEA
GO:0007267	Process	Cell-cell signaling	IBA
GO:0007267	Process	Cell-cell signaling	IEA
GO:0015267	Function	Channel activity	IEA
GO:0016020	Component	Membrane	IEA
GO:0022829	Function	Wide pore channel activity	IBA
GO:0032732	Process	Positive regulation of interleukin-1 production	IEA
GO:0034220	Process	Monoatomic ion transmembrane transport	IEA
GO:0044877	Function	Protein-containing complex binding	IEA
GO:0055077	Function	Gap junction hemi-channel activity	ISS

MIM	HGNC	e!Ensembl
608421	8600	ENSG00000073150

Q96RD6

Protein name

Pannexin-2

Protein function

Ion channel with a slight anion preference (PubMed:36973289). Also able to release ATP (PubMed:36869038). Plays a role in regulating neurogenesis and apoptosis in keratinocytes (By similarity). {ECO:0000250|UniProtKB:Q6IMP4, ECO:0000269|PubMed:3

PDB

7XLB , 8F7C , 8GYQ

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00876	Innexin	49 → 358	Innexin	Family

Sequence

MHHLLEQSADMATALLAGEKLRELILPGAQDDKAGALAALLLQLKLELPFDRVVTIGTVL
VPILLVTLVFTKNFAEEPIYCYTPHNFTRDQALYARGYCWTELRDALPGVDASLWPSLFE
HKFLPYALLAFAAIMYVPALGWEFLASTRLTSELNFLLQEIDNCYHRAAEGRAPKIEKQI
QSKGPGITEREKREIIENAEKEKSPEQNLFEKYLERRGRSNFLAKLYLARHVLILLLSAV
PISYLCTYYATQKQNEFTCALGASPDGAAGAGPAVRVSCKLPSVQLQRIIAGVDIVLLCV
MNLIILVNLIHLFIFRKSNFIFDKLHKVGIKTRRQWRRSQFCDINILAMFCNENRDHIKS
LNRLDFITNESDLMYDNVVRQLLAALAQSNHDATPTVRDSGVQTVDPSANPAEPDGAAEP
PVVKRPRKKMKWIPTSNPLPQPFKEPLAIMRVENSKAEKPKPARRKTATDTLIAPLLDRS
AHHYKGGGGDPGPGPAPAPAPPPAPDKKHARHFSLDVHPYILGTKKAKAEAVPAALPASR
SQEGGFLSQAEDCGLGLAPAPIKDAPLPEKEIPYPTEPARAGLPSGGPFHVRSPPAAPAV
APLTPASLGKAEPLTILSRNATHPLLHINTLYEAREEEDGGPRLPQDVGDLIAIPAPQQI
LIATFDEPRTVVSTVEF

Sequence length

677

Interactions

View interactions

	Reactome
			Electric Transmission Across Gap Junctions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
DYSLEXIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (19)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Autism Spectrum Disorder	Autism	Pubtator	37939567	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	30723706		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	25773474		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	28390953		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	28036289		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	Pubtator	28036289	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fleck corneal dystrophy	Fleck Corneal Dystrophy	BEFREE	28036289		★★★★★ ★☆☆☆☆ Found in Text Mining only
Focal Cortical Dysplasia	Focal cortical dysplasia	Pubtator	28036289	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	19749789, 29928399		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	33913372	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Linear atrophy	Atrophy	BEFREE	27229462		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malformations of Cortical Development	Cortical development malformation	Pubtator	28036289	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	30723706		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	28036289	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	30723706		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	30723706		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	17427027, 26223428		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	25773474		★★★★★ ★☆☆☆☆ Found in Text Mining only

PANX2 (pannexin 2)