KCNK13 (potassium two pore domain channel subfamily K member 13)

Gene

• Entrez ID: 56659
• Gene name: Potassium two pore domain channel subfamily K member 13
• Gene symbol: KCNK13
• Synonyms (NCBI Gene): K2p13.1, THIK-1, THIK1
• Chromosome: 14
• Chromosome location: 14q32.11
• Summary: Potassium channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, e

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT025647	hsa-miR-7-5p	Microarray	17612493
MIRT052700	hsa-miR-1260b	CLASH	23622248
MIRT1081791	hsa-miR-4713-5p	CLIP-seq
MIRT1081792	hsa-miR-543	CLIP-seq
MIRT1081793	hsa-miR-642b	CLIP-seq
MIRT2020257	hsa-miR-1252	CLIP-seq
MIRT2020258	hsa-miR-342-3p	CLIP-seq
MIRT2020259	hsa-miR-4755-3p	CLIP-seq
MIRT2020258	hsa-miR-342-3p	CLIP-seq
MIRT2252091	hsa-miR-873	CLIP-seq
MIRT2020258	hsa-miR-342-3p	CLIP-seq
MIRT2389655	hsa-miR-4645-5p	CLIP-seq
MIRT2389656	hsa-miR-4673	CLIP-seq
MIRT2020259	hsa-miR-4755-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005267	Function	Potassium channel activity	IDA	24163367, 25148687
GO:0005267	Function	Potassium channel activity	IEA
GO:0005515	Function	Protein binding	IPI	25148687
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	24163367, 25148687
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006813	Process	Potassium ion transport	IEA
GO:0015271	Function	Outward rectifier potassium channel activity	IBA
GO:0016020	Component	Membrane	IEA
GO:0022841	Function	Potassium ion leak channel activity	IBA
GO:0034220	Process	Monoatomic ion transmembrane transport	IEA
GO:0034702	Component	Monoatomic ion channel complex	IEA
GO:0042802	Function	Identical protein binding	IDA	25148687
GO:0046872	Function	Metal ion binding	IEA
GO:0046982	Function	Protein heterodimerization activity	IDA	25148687
GO:0060075	Process	Regulation of resting membrane potential	IEA
GO:0060075	Process	Regulation of resting membrane potential	ISS
GO:0071805	Process	Potassium ion transmembrane transport	IBA
GO:0071805	Process	Potassium ion transmembrane transport	IEA
GO:1900225	Process	Regulation of NLRP3 inflammasome complex assembly	IEA
GO:1900225	Process	Regulation of NLRP3 inflammasome complex assembly	ISS
GO:1905810	Process	Regulation of excitatory synapse pruning	IEA
GO:1905810	Process	Regulation of excitatory synapse pruning	ISS

Other IDs

• MIM: 607367
• HGNC: 6275
• e!Ensembl: ENSG00000152315

Protein

• UniProt ID: Q9HB14
• Protein name: Potassium channel subfamily K member 13 (Tandem pore domain halothane-inhibited potassium channel 1) (THIK-1)
• Protein function: K(+) channel that conducts outward rectifying tonic currents potentiated by purinergic signals (PubMed:24163367, PubMed:25148687, PubMed:30472253, PubMed:38409076). Homo- and heterodimerizes to form functional channels with distinct regulatory a
• PDB: 9BSN, 9BWS, 9BYI, 9C07, 9C09, 9FT7
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF07885	Ion_trans_2	76 → 151	Ion channel	Family
  PF07885	Ion_trans_2	195 → 285	Ion channel	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in microglia (at protein level). {ECO:0000269|PubMed:38409076}.
• Sequence:

  MAGRGFSWGPGHLNEDNARFLLLAALIVLYLLGGAAVFSALELAHERQAKQRWEERLANF
  SRGHNLSRDELRGFLRHYEEATRAGIRVDNVRPRWDFTGAFYFVGTVVSTIGFGMTTPAT
  VGGKIFLIFYGLVGCSSTILFFNLFLERLITIIAYIMKSCHQRQLRRRGALPQESLKDAG
  QCEVDSLAGWKPSVYYVMLILCTASILISCCASAMYTPIEGWSYFDSLYFCFVAFSTIGF
  GDLVSSQNAHYESQGLYRFANFVFILMGVCCIYSLFNVISILIKQSLNWILRKMDSGCCP
  QCQRGLLRSRRNVVMPGSVRNRCNISIETDGVAESDTDGRRLSGEMISMKDLLAANKASL
  AILQKQLSEMANGCPHQTSTLARDNEFSGGVGAFAIMNNRLAETSGDR

• Sequence length: 408

Pathways

Reactome:

Tandem pore domain halothane-inhibited K+ channel (THIK)
Phase 4 - resting membrane potential

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
BIPOLAR DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RESTLESS LEGS SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Atrial Fibrillation	Atrial Fibrillation	BEFREE	31182191		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	31182191		★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	31182191		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	37107557	Associate	★☆☆☆☆ Found in Text Mining only