Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	56658
Gene name	Tripartite motif containing 39
Gene symbol	TRIM39
Synonyms (NCBI Gene)	RNF23TFPTRIM39B
Chromosome	6
Chromosome location	6p22.1
Summary	The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The function of this protein has not been identifi

148

Show/Hide all (148)

miRTarBase ID	miRNA	Experiments	Reference
MIRT652199	hsa-miR-1470	HITS-CLIP	23824327
MIRT652198	hsa-miR-4667-3p	HITS-CLIP	23824327
MIRT652197	hsa-miR-5193	HITS-CLIP	23824327
MIRT652196	hsa-miR-877-3p	HITS-CLIP	23824327
MIRT652195	hsa-miR-4469	HITS-CLIP	23824327
MIRT652194	hsa-miR-6515-3p	HITS-CLIP	23824327
MIRT496706	hsa-miR-6808-5p	PAR-CLIP	22291592
MIRT496705	hsa-miR-6893-5p	PAR-CLIP	22291592
MIRT496704	hsa-miR-940	PAR-CLIP	22291592
MIRT496703	hsa-miR-4742-5p	PAR-CLIP	22291592
MIRT496702	hsa-miR-1827	PAR-CLIP	22291592
MIRT496701	hsa-miR-6866-5p	PAR-CLIP	22291592
MIRT439391	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT439391	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT652199	hsa-miR-1470	HITS-CLIP	23824327
MIRT652198	hsa-miR-4667-3p	HITS-CLIP	23824327
MIRT652197	hsa-miR-5193	HITS-CLIP	23824327
MIRT652196	hsa-miR-877-3p	HITS-CLIP	23824327
MIRT652195	hsa-miR-4469	HITS-CLIP	23824327
MIRT652194	hsa-miR-6515-3p	HITS-CLIP	23824327
MIRT496706	hsa-miR-6808-5p	PAR-CLIP	22291592
MIRT496705	hsa-miR-6893-5p	PAR-CLIP	22291592
MIRT496704	hsa-miR-940	PAR-CLIP	22291592
MIRT496703	hsa-miR-4742-5p	PAR-CLIP	22291592
MIRT496702	hsa-miR-1827	PAR-CLIP	22291592
MIRT496701	hsa-miR-6866-5p	PAR-CLIP	22291592
MIRT1454659	hsa-miR-1237	CLIP-seq
MIRT1454660	hsa-miR-1238	CLIP-seq
MIRT1454661	hsa-miR-1248	CLIP-seq
MIRT1454662	hsa-miR-3064-3p	CLIP-seq
MIRT1454663	hsa-miR-3124-3p	CLIP-seq
MIRT1454664	hsa-miR-3133	CLIP-seq
MIRT1454665	hsa-miR-3157-5p	CLIP-seq
MIRT1454666	hsa-miR-3160-5p	CLIP-seq
MIRT1454667	hsa-miR-3176	CLIP-seq
MIRT1454668	hsa-miR-345	CLIP-seq
MIRT1454669	hsa-miR-3685	CLIP-seq
MIRT1454670	hsa-miR-382	CLIP-seq
MIRT1454671	hsa-miR-3922-3p	CLIP-seq
MIRT1454672	hsa-miR-3926	CLIP-seq
MIRT1454673	hsa-miR-3973	CLIP-seq
MIRT1454674	hsa-miR-3976	CLIP-seq
MIRT1454675	hsa-miR-4286	CLIP-seq
MIRT1454676	hsa-miR-4305	CLIP-seq
MIRT1454677	hsa-miR-4712-3p	CLIP-seq
MIRT1454678	hsa-miR-4713-5p	CLIP-seq
MIRT1454679	hsa-miR-4715-3p	CLIP-seq
MIRT1454680	hsa-miR-4753-3p	CLIP-seq
MIRT1454681	hsa-miR-548b-3p	CLIP-seq
MIRT1454682	hsa-miR-548l	CLIP-seq
MIRT1454683	hsa-miR-548s	CLIP-seq
MIRT1454684	hsa-miR-942	CLIP-seq
MIRT1454685	hsa-miR-1207-5p	CLIP-seq
MIRT1454686	hsa-miR-124	CLIP-seq
MIRT1454687	hsa-miR-1267	CLIP-seq
MIRT1454688	hsa-miR-1292	CLIP-seq
MIRT1454689	hsa-miR-140-3p	CLIP-seq
MIRT1454662	hsa-miR-3064-3p	CLIP-seq
MIRT1454664	hsa-miR-3133	CLIP-seq
MIRT1454690	hsa-miR-3150b-3p	CLIP-seq
MIRT1454691	hsa-miR-3620	CLIP-seq
MIRT1454692	hsa-miR-3649	CLIP-seq
MIRT1454693	hsa-miR-3660	CLIP-seq
MIRT1454694	hsa-miR-3661	CLIP-seq
MIRT1454695	hsa-miR-378	CLIP-seq
MIRT1454696	hsa-miR-378b	CLIP-seq
MIRT1454697	hsa-miR-378c	CLIP-seq
MIRT1454698	hsa-miR-378d	CLIP-seq
MIRT1454699	hsa-miR-378e	CLIP-seq
MIRT1454700	hsa-miR-378f	CLIP-seq
MIRT1454701	hsa-miR-378h	CLIP-seq
MIRT1454702	hsa-miR-378i	CLIP-seq
MIRT1454703	hsa-miR-3928	CLIP-seq
MIRT1454704	hsa-miR-3929	CLIP-seq
MIRT1454674	hsa-miR-3976	CLIP-seq
MIRT1454705	hsa-miR-422a	CLIP-seq
MIRT1454706	hsa-miR-4266	CLIP-seq
MIRT1454707	hsa-miR-4267	CLIP-seq
MIRT1454708	hsa-miR-4279	CLIP-seq
MIRT1454675	hsa-miR-4286	CLIP-seq
MIRT1454709	hsa-miR-4419b	CLIP-seq
MIRT1454710	hsa-miR-4471	CLIP-seq
MIRT1454711	hsa-miR-4478	CLIP-seq
MIRT1454712	hsa-miR-4493	CLIP-seq
MIRT1454713	hsa-miR-4526	CLIP-seq
MIRT1454714	hsa-miR-4536	CLIP-seq
MIRT1454715	hsa-miR-4638-3p	CLIP-seq
MIRT1454716	hsa-miR-4645-3p	CLIP-seq
MIRT1454717	hsa-miR-4646-5p	CLIP-seq
MIRT1454718	hsa-miR-4649-3p	CLIP-seq
MIRT1454719	hsa-miR-4695-5p	CLIP-seq
MIRT1454679	hsa-miR-4715-3p	CLIP-seq
MIRT1454720	hsa-miR-4732-3p	CLIP-seq
MIRT1454721	hsa-miR-4763-3p	CLIP-seq
MIRT1454722	hsa-miR-4779	CLIP-seq
MIRT1454723	hsa-miR-4784	CLIP-seq
MIRT1454724	hsa-miR-492	CLIP-seq
MIRT1454725	hsa-miR-506	CLIP-seq
MIRT1454726	hsa-miR-548ag	CLIP-seq
MIRT1454727	hsa-miR-548ai	CLIP-seq
MIRT1454681	hsa-miR-548b-3p	CLIP-seq
MIRT1454728	hsa-miR-548m	CLIP-seq
MIRT1454729	hsa-miR-631	CLIP-seq
MIRT1454730	hsa-miR-765	CLIP-seq
MIRT2136200	hsa-miR-516b	CLIP-seq
MIRT1454685	hsa-miR-1207-5p	CLIP-seq
MIRT1454688	hsa-miR-1292	CLIP-seq
MIRT2650865	hsa-miR-1913	CLIP-seq
MIRT2650866	hsa-miR-204	CLIP-seq
MIRT2650867	hsa-miR-211	CLIP-seq
MIRT2650868	hsa-miR-216b	CLIP-seq
MIRT2650869	hsa-miR-2964a-5p	CLIP-seq
MIRT2650870	hsa-miR-3122	CLIP-seq
MIRT1454666	hsa-miR-3160-5p	CLIP-seq
MIRT2650871	hsa-miR-3189-3p	CLIP-seq
MIRT2650872	hsa-miR-324-3p	CLIP-seq
MIRT2650873	hsa-miR-3614-3p	CLIP-seq
MIRT1454692	hsa-miR-3649	CLIP-seq
MIRT1454694	hsa-miR-3661	CLIP-seq
MIRT2650874	hsa-miR-3689a-3p	CLIP-seq
MIRT2650875	hsa-miR-3689c	CLIP-seq
MIRT2650876	hsa-miR-3691-3p	CLIP-seq
MIRT2650877	hsa-miR-3913-5p	CLIP-seq
MIRT1454704	hsa-miR-3929	CLIP-seq
MIRT1454674	hsa-miR-3976	CLIP-seq
MIRT1454708	hsa-miR-4279	CLIP-seq
MIRT2650878	hsa-miR-4290	CLIP-seq
MIRT2650879	hsa-miR-4312	CLIP-seq
MIRT1454709	hsa-miR-4419b	CLIP-seq
MIRT1454710	hsa-miR-4471	CLIP-seq
MIRT1454711	hsa-miR-4478	CLIP-seq
MIRT1454712	hsa-miR-4493	CLIP-seq
MIRT2650880	hsa-miR-4522	CLIP-seq
MIRT1454718	hsa-miR-4649-3p	CLIP-seq
MIRT2650881	hsa-miR-4725-5p	CLIP-seq
MIRT2650882	hsa-miR-4755-5p	CLIP-seq
MIRT1454721	hsa-miR-4763-3p	CLIP-seq
MIRT2650883	hsa-miR-4780	CLIP-seq
MIRT1454724	hsa-miR-492	CLIP-seq
MIRT2650884	hsa-miR-504	CLIP-seq
MIRT2650885	hsa-miR-548ae	CLIP-seq
MIRT2650886	hsa-miR-548aj	CLIP-seq
MIRT2650887	hsa-miR-548am	CLIP-seq
MIRT2650888	hsa-miR-548x	CLIP-seq
MIRT2650889	hsa-miR-623	CLIP-seq
MIRT1454729	hsa-miR-631	CLIP-seq
MIRT2650890	hsa-miR-653	CLIP-seq
MIRT2650891	hsa-miR-802	CLIP-seq

Show/Hide all (30)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	16189514, 17474147, 19100260, 19549727, 21516116, 22493164, 23213251, 25416956, 25910212, 26363554, 27107012, 29892012, 31515488, 32296183, 32814053
GO:0005634	Component	Nucleus	IDA	23213251
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IDA	19100260
GO:0005739	Component	Mitochondrion	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA	19100260
GO:0005829	Component	Cytosol	IEA
GO:0006915	Process	Apoptotic process	IEA
GO:0007095	Process	Mitotic G2 DNA damage checkpoint signaling	IMP	23213251
GO:0008270	Function	Zinc ion binding	IEA
GO:0010468	Process	Regulation of gene expression	IBA
GO:0016567	Process	Protein ubiquitination	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0032435	Process	Negative regulation of proteasomal ubiquitin-dependent protein catabolic process	IBA
GO:0032435	Process	Negative regulation of proteasomal ubiquitin-dependent protein catabolic process	IMP	23213251
GO:0042802	Function	Identical protein binding	IPI	16189514, 21516116, 22493164, 25416956, 32296183
GO:0043124	Process	Negative regulation of canonical NF-kappaB signal transduction	IMP	26363554
GO:0045087	Process	Innate immune response	IBA
GO:0046872	Function	Metal ion binding	IEA
GO:0050821	Process	Protein stabilization	IBA
GO:0050821	Process	Protein stabilization	IMP	23213251, 26363554
GO:0061630	Function	Ubiquitin protein ligase activity	IBA
GO:0061630	Function	Ubiquitin protein ligase activity	IEA
GO:1902806	Process	Regulation of cell cycle G1/S phase transition	IMP	23213251
GO:2000059	Process	Negative regulation of ubiquitin-dependent protein catabolic process	IDA	19100260
GO:2001235	Process	Positive regulation of apoptotic signaling pathway	IBA
GO:2001235	Process	Positive regulation of apoptotic signaling pathway	IDA	19100260

MIM	HGNC	e!Ensembl
605700	10065	ENSG00000204599

Q9HCM9

Protein name

E3 ubiquitin-protein ligase TRIM39 (EC 2.3.2.27) (RING finger protein 23) (RING-type E3 ubiquitin transferase TRIM39) (Testis-abundant finger protein) (Tripartite motif-containing protein 39)

Protein function

[Isoform 1]: E3 ubiquitin-protein ligase (PubMed:22529100). May facilitate apoptosis by inhibiting APC/C-Cdh1-mediated poly-ubiquitination and subsequent proteasome-mediated degradation of the pro-apoptotic protein MOAP1 (PubMed:19100260, PubMed

PDB

2DID , 2DIF , 2ECJ

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF15227	zf-C3HC4_4	29 → 69		Domain
PF00643	zf-B_box	102 → 143	B-box zinc finger	Domain
PF13765	PRY	339 → 388	SPRY-associated domain	Family
PF00622	SPRY	392 → 509	SPRY domain	Family

Tissue specificity

TISSUE SPECIFICITY: Ubiquitous; highly expressed in brain, heart, kidney, liver, skeletal muscle, spleen and testis. {ECO:0000269|PubMed:19100260}.

Sequence

MAETSLLEAGASAASTAAALENLQVEASCSVCLEYLKEPVIIECGHNFCKACITRWWEDL
ERDFPCPVCRKTSRYRSLRPNRQLGSMVEIAKQLQAVKRKIRDESLCPQHHEALSLFCYE
DQEAVCLICAISHTHRAHTVVPLDDATQEYKEKLQKCLEPLEQKLQEITRCKSSEEKKPG
ELKRLVESRRQQILREFEELHRRLDEEQQVLLSRLEEEEQDILQRLRENAAHLGDKRRDL
AHLAAEVEGKCLQSGFEMLKDVKSTLEKNIPRKFGGSLSTICPRDHKALLGLVKEINRCE
KVKTMEVTSVSIELEKNFSNFPRQYFALRKILKQLIADVTLDPETAHPNLVLSEDRKSVK
FVETRLRDLPDTPRRFTFYPCVLATEGFTSGRHYWEVEVGDKTHWAVGVCRDSVSRKGEL
TPLPETGYWRVRLWNGDKYAATTTPFTPLHIKVKPKRVGIFLDYEAGTLSFYNVTDRSHI
YTFTDTFTEKLWPLFYPGIRAGRKNAAPLTIRPPTDWE

Sequence length

518

Interactions

View interactions

	Reactome
			Antigen processing: Ubiquitination & Proteasome degradation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CHRONIC INTERSTITIAL CYSTITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CUTANEOUS LUPUS ERYTHEMATOSUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (15)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Barrett Esophagus	Barrett esophagus	BEFREE	25827949		★★★★★ ★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	20875797		★★★★★ ★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet disease	Pubtator	26363554	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	35833210	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Ataxia with Central Nervous System Hypomyelinization	Leukoencephalopathy with vanishing white matter	BEFREE	25827949		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	26419460	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	26419460		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	26419460	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Intellectual developmental disorder	Pubtator	23213260	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Cutaneous	Lupus Erythematosus	GWASCAT_DG	25827949		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	33311639	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	34643308	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary fibrosis	Pubtator	30756084	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	GWASDB_DG	19503088		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Trifunctional Protein Deficiency With Myopathy And Neuropathy	Mitochondrial trifunctional protein deficiency	BEFREE	12754706, 20425236		★★★★★ ★☆☆☆☆ Found in Text Mining only

TRIM39 (tripartite motif containing 39)