NPDC1 (neural proliferation, differentiation and control 1)

Gene

• Entrez ID: 56654
• Gene name: Neural proliferation, differentiation and control 1
• Gene symbol: NPDC1
• Synonyms (NCBI Gene): CAB, CAB-, CAB-1, CAB1, NPDC-1
• Chromosome: 9
• Chromosome location: 9q34.3

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT044185	hsa-miR-99b-5p	CLASH	23622248
MIRT1190562	hsa-miR-1323	CLIP-seq
MIRT1190563	hsa-miR-1909	CLIP-seq
MIRT1190564	hsa-miR-3144-5p	CLIP-seq
MIRT1190565	hsa-miR-4768-3p	CLIP-seq
MIRT1190566	hsa-miR-548o	CLIP-seq
MIRT2055180	hsa-miR-1254	CLIP-seq
MIRT2055181	hsa-miR-2861	CLIP-seq
MIRT2055182	hsa-miR-3116	CLIP-seq
MIRT2055183	hsa-miR-4254	CLIP-seq
MIRT2055180	hsa-miR-1254	CLIP-seq
MIRT2055181	hsa-miR-2861	CLIP-seq
MIRT2055182	hsa-miR-3116	CLIP-seq
MIRT2055183	hsa-miR-4254	CLIP-seq
MIRT2055180	hsa-miR-1254	CLIP-seq
MIRT2582211	hsa-miR-1915	CLIP-seq
MIRT2055181	hsa-miR-2861	CLIP-seq
MIRT2582212	hsa-miR-31	CLIP-seq
MIRT2055182	hsa-miR-3116	CLIP-seq
MIRT2582213	hsa-miR-3128	CLIP-seq
MIRT2582214	hsa-miR-3918	CLIP-seq
MIRT2582215	hsa-miR-3936	CLIP-seq
MIRT2055183	hsa-miR-4254	CLIP-seq
MIRT2582216	hsa-miR-4287	CLIP-seq
MIRT2582217	hsa-miR-4292	CLIP-seq
MIRT2582218	hsa-miR-4308	CLIP-seq
MIRT2582219	hsa-miR-4469	CLIP-seq
MIRT2582220	hsa-miR-4512	CLIP-seq
MIRT2582221	hsa-miR-4685-3p	CLIP-seq
MIRT2582222	hsa-miR-4685-5p	CLIP-seq
MIRT2582223	hsa-miR-4726-3p	CLIP-seq
MIRT2582224	hsa-miR-4787-5p	CLIP-seq
MIRT2582225	hsa-miR-615-5p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	16189514, 22396535, 25416956, 30388101, 32296183
GO:0005886	Component	Plasma membrane	TAS
GO:0016020	Component	Membrane	IEA

Other IDs

• MIM: 605798
• HGNC: 7899
• e!Ensembl: ENSG00000107281

Protein

• UniProt ID: Q9NQX5
• Protein name: Neural proliferation differentiation and control protein 1 (NPDC-1)
• Protein function: Suppresses oncogenic transformation in neural and non-neural cells and down-regulates neural cell proliferation. Might be involved in transcriptional regulation (By similarity).
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF06809	NPDC1	1 → 325	Neural proliferation differentiation control-1 protein (NPDC1)	Family

• Tissue specificity: TISSUE SPECIFICITY: Strongly expressed in adult brain; especially in hippocampus, frontal lobe and temporal lobe.
• Sequence:

  MATPLPPPSPRHLRLLRLLLSGLVLGAALRGAAAGHPDVAACPGSLDCALKRRARCPPGA
  HACGPCLQPFQEDQQGLCVPRMRRPPGGGRPQPRLEDEIDFLAQELARKESGHSTPPLPK
  DRQRLPEPATLGFSARGQGLELGLPSTPGTPTPTPHTSLGSPVSSDPVHMSPLEPRGGQG
  DGLALVLILAFCVAGAAALSVASLCWCRLQREIRLTQKADYATAKAPGSPAAPRISPGDQ
  RLAQSAEMYHYQHQRQQMLCLERHKEPPKELDTASSDEENEDGDFTVYECPGLAPTGEME
  VRNPLFDHAALSAPLPAPSSPPALP

• Sequence length: 325

Pathways

Reactome:

Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acromegaly	Acromegaly	BEFREE	28931779		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	18482205		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	21124956		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	21124956	Associate	★☆☆☆☆ Found in Text Mining only
Gastroesophageal reflux disease	Gastroesophageal Reflux Disease	BEFREE	28501868, 29870976, 30589965, 31045597		★☆☆☆☆ Found in Text Mining only
Hyperplasia	Hyperplasia	Pubtator	7541167	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	BEFREE	30403833		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	18482205		★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	BEFREE	31728906		★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	36613877	Associate	★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	31576390		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	30025813		★☆☆☆☆ Found in Text Mining only
Prolactinoma	Prolactinoma	BEFREE	31728906		★☆☆☆☆ Found in Text Mining only
Sleep Disorders	Sleep Disorders	BEFREE	28501868		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	36578802	Associate	★☆☆☆☆ Found in Text Mining only