Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	56616
Gene name	Diablo IAP-binding mitochondrial protein
Gene symbol	DIABLO
Synonyms (NCBI Gene)	DFNA64SMAC
Chromosome	12
Chromosome location	12q24.31
Summary	This gene encodes an inhibitor of apoptosis protein (IAP)-binding protein. The encoded mitochondrial protein enters the cytosol when cells undergo apoptosis, and allows activation of caspases by binding to inhibitor of apoptosis proteins. Overexpression o

Show/Hide all (2)

SNP ID	Visualize variation	Clinical significance	Consequence
rs370571609	A>T	Likely-benign, conflicting-interpretations-of-pathogenicity	Intron variant
rs387906893	G>A	Pathogenic	Missense variant, coding sequence variant

411

Show/Hide all (411)

miRTarBase ID	miRNA	Experiments	Reference
MIRT005907	hsa-miR-29a-3p	qRT-PCR	21169019
MIRT029197	hsa-miR-26b-5p	Microarray	19088304
MIRT031535	hsa-miR-16-5p	Proteomics	18668040
MIRT047377	hsa-miR-34a-5p	CLASH	23622248
MIRT508672	hsa-miR-4506	PAR-CLIP	20371350
MIRT508671	hsa-miR-2278	PAR-CLIP	20371350
MIRT508670	hsa-miR-646	PAR-CLIP	20371350
MIRT508669	hsa-let-7a-5p	PAR-CLIP	20371350
MIRT508668	hsa-let-7b-5p	PAR-CLIP	20371350
MIRT508667	hsa-let-7c-5p	PAR-CLIP	20371350
MIRT508666	hsa-let-7d-5p	PAR-CLIP	20371350
MIRT508665	hsa-let-7e-5p	PAR-CLIP	20371350
MIRT508664	hsa-let-7f-5p	PAR-CLIP	20371350
MIRT508663	hsa-let-7g-5p	PAR-CLIP	20371350
MIRT508662	hsa-let-7i-5p	PAR-CLIP	20371350
MIRT508661	hsa-miR-4458	PAR-CLIP	20371350
MIRT508660	hsa-miR-4500	PAR-CLIP	20371350
MIRT508659	hsa-miR-98-5p	PAR-CLIP	20371350
MIRT508658	hsa-miR-202-3p	PAR-CLIP	20371350
MIRT508656	hsa-miR-555	PAR-CLIP	20371350
MIRT508655	hsa-miR-6772-5p	PAR-CLIP	20371350
MIRT508654	hsa-miR-4455	PAR-CLIP	20371350
MIRT508653	hsa-miR-609	PAR-CLIP	20371350
MIRT508652	hsa-miR-4316	PAR-CLIP	20371350
MIRT508651	hsa-miR-1294	PAR-CLIP	20371350
MIRT508650	hsa-miR-1262	PAR-CLIP	20371350
MIRT508649	hsa-miR-4701-3p	PAR-CLIP	20371350
MIRT508648	hsa-miR-6736-5p	PAR-CLIP	20371350
MIRT508647	hsa-miR-6741-5p	PAR-CLIP	20371350
MIRT508672	hsa-miR-4506	PAR-CLIP	23446348
MIRT508671	hsa-miR-2278	PAR-CLIP	23446348
MIRT508670	hsa-miR-646	PAR-CLIP	23446348
MIRT508669	hsa-let-7a-5p	PAR-CLIP	23446348
MIRT508668	hsa-let-7b-5p	PAR-CLIP	23446348
MIRT508667	hsa-let-7c-5p	PAR-CLIP	23446348
MIRT508666	hsa-let-7d-5p	PAR-CLIP	23446348
MIRT508665	hsa-let-7e-5p	PAR-CLIP	23446348
MIRT508664	hsa-let-7f-5p	PAR-CLIP	23446348
MIRT508663	hsa-let-7g-5p	PAR-CLIP	23446348
MIRT508662	hsa-let-7i-5p	PAR-CLIP	23446348
MIRT508661	hsa-miR-4458	PAR-CLIP	23446348
MIRT508660	hsa-miR-4500	PAR-CLIP	23446348
MIRT508659	hsa-miR-98-5p	PAR-CLIP	23446348
MIRT508658	hsa-miR-202-3p	PAR-CLIP	23446348
MIRT508657	hsa-miR-1251-3p	PAR-CLIP	23446348
MIRT508656	hsa-miR-555	PAR-CLIP	23446348
MIRT508655	hsa-miR-6772-5p	PAR-CLIP	23446348
MIRT508654	hsa-miR-4455	PAR-CLIP	23446348
MIRT508653	hsa-miR-609	PAR-CLIP	23446348
MIRT508652	hsa-miR-4316	PAR-CLIP	23446348
MIRT508651	hsa-miR-1294	PAR-CLIP	23446348
MIRT508650	hsa-miR-1262	PAR-CLIP	23446348
MIRT508649	hsa-miR-4701-3p	PAR-CLIP	23446348
MIRT508648	hsa-miR-6736-5p	PAR-CLIP	23446348
MIRT508647	hsa-miR-6741-5p	PAR-CLIP	23446348
MIRT440818	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT440818	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT047377	hsa-miR-34a-5p	PCR array	28097098
MIRT508672	hsa-miR-4506	PAR-CLIP	20371350
MIRT508671	hsa-miR-2278	PAR-CLIP	20371350
MIRT508670	hsa-miR-646	PAR-CLIP	20371350
MIRT508669	hsa-let-7a-5p	PAR-CLIP	20371350
MIRT508668	hsa-let-7b-5p	PAR-CLIP	20371350
MIRT508667	hsa-let-7c-5p	PAR-CLIP	20371350
MIRT508666	hsa-let-7d-5p	PAR-CLIP	20371350
MIRT508665	hsa-let-7e-5p	PAR-CLIP	20371350
MIRT508664	hsa-let-7f-5p	PAR-CLIP	20371350
MIRT508663	hsa-let-7g-5p	PAR-CLIP	20371350
MIRT508662	hsa-let-7i-5p	PAR-CLIP	20371350
MIRT508661	hsa-miR-4458	PAR-CLIP	20371350
MIRT508660	hsa-miR-4500	PAR-CLIP	20371350
MIRT508659	hsa-miR-98-5p	PAR-CLIP	20371350
MIRT508658	hsa-miR-202-3p	PAR-CLIP	20371350
MIRT508656	hsa-miR-555	PAR-CLIP	20371350
MIRT508655	hsa-miR-6772-5p	PAR-CLIP	20371350
MIRT508654	hsa-miR-4455	PAR-CLIP	20371350
MIRT508653	hsa-miR-609	PAR-CLIP	20371350
MIRT508652	hsa-miR-4316	PAR-CLIP	20371350
MIRT508651	hsa-miR-1294	PAR-CLIP	20371350
MIRT508650	hsa-miR-1262	PAR-CLIP	20371350
MIRT508649	hsa-miR-4701-3p	PAR-CLIP	20371350
MIRT508648	hsa-miR-6736-5p	PAR-CLIP	20371350
MIRT508647	hsa-miR-6741-5p	PAR-CLIP	20371350
MIRT508672	hsa-miR-4506	PAR-CLIP	23446348
MIRT508671	hsa-miR-2278	PAR-CLIP	23446348
MIRT508670	hsa-miR-646	PAR-CLIP	23446348
MIRT508669	hsa-let-7a-5p	PAR-CLIP	23446348
MIRT508668	hsa-let-7b-5p	PAR-CLIP	23446348
MIRT508667	hsa-let-7c-5p	PAR-CLIP	23446348
MIRT508666	hsa-let-7d-5p	PAR-CLIP	23446348
MIRT508665	hsa-let-7e-5p	PAR-CLIP	23446348
MIRT508664	hsa-let-7f-5p	PAR-CLIP	23446348
MIRT508663	hsa-let-7g-5p	PAR-CLIP	23446348
MIRT508662	hsa-let-7i-5p	PAR-CLIP	23446348
MIRT508661	hsa-miR-4458	PAR-CLIP	23446348
MIRT508660	hsa-miR-4500	PAR-CLIP	23446348
MIRT508659	hsa-miR-98-5p	PAR-CLIP	23446348
MIRT508658	hsa-miR-202-3p	PAR-CLIP	23446348
MIRT508657	hsa-miR-1251-3p	PAR-CLIP	23446348
MIRT508656	hsa-miR-555	PAR-CLIP	23446348
MIRT508655	hsa-miR-6772-5p	PAR-CLIP	23446348
MIRT508654	hsa-miR-4455	PAR-CLIP	23446348
MIRT508653	hsa-miR-609	PAR-CLIP	23446348
MIRT508652	hsa-miR-4316	PAR-CLIP	23446348
MIRT508651	hsa-miR-1294	PAR-CLIP	23446348
MIRT508650	hsa-miR-1262	PAR-CLIP	23446348
MIRT508649	hsa-miR-4701-3p	PAR-CLIP	23446348
MIRT508648	hsa-miR-6736-5p	PAR-CLIP	23446348
MIRT508647	hsa-miR-6741-5p	PAR-CLIP	23446348
MIRT935796	hsa-let-7a	CLIP-seq
MIRT935797	hsa-let-7b	CLIP-seq
MIRT935798	hsa-let-7c	CLIP-seq
MIRT935799	hsa-let-7d	CLIP-seq
MIRT935800	hsa-let-7e	CLIP-seq
MIRT935801	hsa-let-7f	CLIP-seq
MIRT935802	hsa-let-7g	CLIP-seq
MIRT935803	hsa-let-7i	CLIP-seq
MIRT935804	hsa-miR-1207-3p	CLIP-seq
MIRT935805	hsa-miR-202	CLIP-seq
MIRT935806	hsa-miR-3189-3p	CLIP-seq
MIRT935807	hsa-miR-383	CLIP-seq
MIRT935808	hsa-miR-3909	CLIP-seq
MIRT935809	hsa-miR-3919	CLIP-seq
MIRT935810	hsa-miR-3925-5p	CLIP-seq
MIRT935811	hsa-miR-4436a	CLIP-seq
MIRT935812	hsa-miR-4447	CLIP-seq
MIRT935813	hsa-miR-4464	CLIP-seq
MIRT935814	hsa-miR-4472	CLIP-seq
MIRT935815	hsa-miR-4488	CLIP-seq
MIRT935816	hsa-miR-4697-5p	CLIP-seq
MIRT935817	hsa-miR-4698	CLIP-seq
MIRT935818	hsa-miR-4700-3p	CLIP-seq
MIRT935819	hsa-miR-4726-3p	CLIP-seq
MIRT935820	hsa-miR-4748	CLIP-seq
MIRT935821	hsa-miR-4756-3p	CLIP-seq
MIRT935822	hsa-miR-4757-5p	CLIP-seq
MIRT935823	hsa-miR-483-3p	CLIP-seq
MIRT935824	hsa-miR-486-3p	CLIP-seq
MIRT935825	hsa-miR-5096	CLIP-seq
MIRT935826	hsa-miR-513a-5p	CLIP-seq
MIRT935827	hsa-miR-520d-5p	CLIP-seq
MIRT935828	hsa-miR-524-5p	CLIP-seq
MIRT935829	hsa-miR-98	CLIP-seq
MIRT935796	hsa-let-7a	CLIP-seq
MIRT935797	hsa-let-7b	CLIP-seq
MIRT935798	hsa-let-7c	CLIP-seq
MIRT935799	hsa-let-7d	CLIP-seq
MIRT935800	hsa-let-7e	CLIP-seq
MIRT935801	hsa-let-7f	CLIP-seq
MIRT935802	hsa-let-7g	CLIP-seq
MIRT935803	hsa-let-7i	CLIP-seq
MIRT935830	hsa-miR-1207-5p	CLIP-seq
MIRT935831	hsa-miR-1252	CLIP-seq
MIRT935832	hsa-miR-1285	CLIP-seq
MIRT935833	hsa-miR-1913	CLIP-seq
MIRT935805	hsa-miR-202	CLIP-seq
MIRT935834	hsa-miR-3152-3p	CLIP-seq
MIRT935835	hsa-miR-3160-5p	CLIP-seq
MIRT935836	hsa-miR-3187-5p	CLIP-seq
MIRT935837	hsa-miR-324-3p	CLIP-seq
MIRT935838	hsa-miR-3612	CLIP-seq
MIRT935839	hsa-miR-4292	CLIP-seq
MIRT935840	hsa-miR-4459	CLIP-seq
MIRT935841	hsa-miR-4476	CLIP-seq
MIRT935842	hsa-miR-4533	CLIP-seq
MIRT935843	hsa-miR-4642	CLIP-seq
MIRT935844	hsa-miR-4695-5p	CLIP-seq
MIRT935845	hsa-miR-4719	CLIP-seq
MIRT935846	hsa-miR-4749-3p	CLIP-seq
MIRT935847	hsa-miR-4763-3p	CLIP-seq
MIRT935848	hsa-miR-570	CLIP-seq
MIRT935849	hsa-miR-612	CLIP-seq
MIRT935850	hsa-miR-628-5p	CLIP-seq
MIRT935851	hsa-miR-650	CLIP-seq
MIRT935829	hsa-miR-98	CLIP-seq
MIRT935796	hsa-let-7a	CLIP-seq
MIRT935797	hsa-let-7b	CLIP-seq
MIRT935798	hsa-let-7c	CLIP-seq
MIRT935799	hsa-let-7d	CLIP-seq
MIRT935800	hsa-let-7e	CLIP-seq
MIRT935801	hsa-let-7f	CLIP-seq
MIRT935802	hsa-let-7g	CLIP-seq
MIRT935803	hsa-let-7i	CLIP-seq
MIRT935805	hsa-miR-202	CLIP-seq
MIRT935817	hsa-miR-4698	CLIP-seq
MIRT935829	hsa-miR-98	CLIP-seq
MIRT1976989	hsa-miR-3064-3p	CLIP-seq
MIRT935826	hsa-miR-513a-5p	CLIP-seq
MIRT935796	hsa-let-7a	CLIP-seq
MIRT935797	hsa-let-7b	CLIP-seq
MIRT935798	hsa-let-7c	CLIP-seq
MIRT935799	hsa-let-7d	CLIP-seq
MIRT935800	hsa-let-7e	CLIP-seq
MIRT935801	hsa-let-7f	CLIP-seq
MIRT935802	hsa-let-7g	CLIP-seq
MIRT935803	hsa-let-7i	CLIP-seq
MIRT935804	hsa-miR-1207-3p	CLIP-seq
MIRT2212425	hsa-miR-1267	CLIP-seq
MIRT935805	hsa-miR-202	CLIP-seq
MIRT2212426	hsa-miR-29a	CLIP-seq
MIRT2212427	hsa-miR-29b	CLIP-seq
MIRT2212428	hsa-miR-29c	CLIP-seq
MIRT1976989	hsa-miR-3064-3p	CLIP-seq
MIRT2212429	hsa-miR-30a	CLIP-seq
MIRT2212430	hsa-miR-30b	CLIP-seq
MIRT2212431	hsa-miR-30c	CLIP-seq
MIRT2212432	hsa-miR-30d	CLIP-seq
MIRT2212433	hsa-miR-30e	CLIP-seq
MIRT2212434	hsa-miR-3187-3p	CLIP-seq
MIRT935806	hsa-miR-3189-3p	CLIP-seq
MIRT2212435	hsa-miR-3663-3p	CLIP-seq
MIRT935807	hsa-miR-383	CLIP-seq
MIRT935808	hsa-miR-3909	CLIP-seq
MIRT935809	hsa-miR-3919	CLIP-seq
MIRT935810	hsa-miR-3925-5p	CLIP-seq
MIRT2212436	hsa-miR-4435	CLIP-seq
MIRT935811	hsa-miR-4436a	CLIP-seq
MIRT2212437	hsa-miR-4436b-3p	CLIP-seq
MIRT935812	hsa-miR-4447	CLIP-seq
MIRT935814	hsa-miR-4472	CLIP-seq
MIRT935815	hsa-miR-4488	CLIP-seq
MIRT2212438	hsa-miR-4685-5p	CLIP-seq
MIRT935816	hsa-miR-4697-5p	CLIP-seq
MIRT935817	hsa-miR-4698	CLIP-seq
MIRT935818	hsa-miR-4700-3p	CLIP-seq
MIRT2212439	hsa-miR-4701-5p	CLIP-seq
MIRT2212440	hsa-miR-4733-3p	CLIP-seq
MIRT935821	hsa-miR-4756-3p	CLIP-seq
MIRT935822	hsa-miR-4757-5p	CLIP-seq
MIRT935823	hsa-miR-483-3p	CLIP-seq
MIRT935824	hsa-miR-486-3p	CLIP-seq
MIRT2212441	hsa-miR-509-3p	CLIP-seq
MIRT935826	hsa-miR-513a-5p	CLIP-seq
MIRT2212442	hsa-miR-548s	CLIP-seq
MIRT2212443	hsa-miR-588	CLIP-seq
MIRT935829	hsa-miR-98	CLIP-seq
MIRT935796	hsa-let-7a	CLIP-seq
MIRT935797	hsa-let-7b	CLIP-seq
MIRT935798	hsa-let-7c	CLIP-seq
MIRT935799	hsa-let-7d	CLIP-seq
MIRT935800	hsa-let-7e	CLIP-seq
MIRT935801	hsa-let-7f	CLIP-seq
MIRT935802	hsa-let-7g	CLIP-seq
MIRT935803	hsa-let-7i	CLIP-seq
MIRT935830	hsa-miR-1207-5p	CLIP-seq
MIRT2516076	hsa-miR-1250	CLIP-seq
MIRT935832	hsa-miR-1285	CLIP-seq
MIRT2516077	hsa-miR-1324	CLIP-seq
MIRT2516078	hsa-miR-140-3p	CLIP-seq
MIRT935833	hsa-miR-1913	CLIP-seq
MIRT2516079	hsa-miR-1972	CLIP-seq
MIRT935805	hsa-miR-202	CLIP-seq
MIRT2516080	hsa-miR-203	CLIP-seq
MIRT2516081	hsa-miR-2355-5p	CLIP-seq
MIRT1976989	hsa-miR-3064-3p	CLIP-seq
MIRT2516082	hsa-miR-3150a-3p	CLIP-seq
MIRT935835	hsa-miR-3160-5p	CLIP-seq
MIRT2516083	hsa-miR-3175	CLIP-seq
MIRT2516084	hsa-miR-3186-5p	CLIP-seq
MIRT2212434	hsa-miR-3187-3p	CLIP-seq
MIRT935836	hsa-miR-3187-5p	CLIP-seq
MIRT935837	hsa-miR-324-3p	CLIP-seq
MIRT2516085	hsa-miR-324-5p	CLIP-seq
MIRT2516086	hsa-miR-342-5p	CLIP-seq
MIRT2516087	hsa-miR-34a	CLIP-seq
MIRT2516088	hsa-miR-34c-5p	CLIP-seq
MIRT935838	hsa-miR-3612	CLIP-seq
MIRT2516089	hsa-miR-3679-3p	CLIP-seq
MIRT2516090	hsa-miR-371b-3p	CLIP-seq
MIRT2516091	hsa-miR-4253	CLIP-seq
MIRT2516092	hsa-miR-4286	CLIP-seq
MIRT935839	hsa-miR-4292	CLIP-seq
MIRT2516093	hsa-miR-4302	CLIP-seq
MIRT2516094	hsa-miR-4432	CLIP-seq
MIRT2212436	hsa-miR-4435	CLIP-seq
MIRT2212437	hsa-miR-4436b-3p	CLIP-seq
MIRT935840	hsa-miR-4459	CLIP-seq
MIRT2516095	hsa-miR-4481	CLIP-seq
MIRT2516096	hsa-miR-4484	CLIP-seq
MIRT2516097	hsa-miR-4499	CLIP-seq
MIRT2516098	hsa-miR-449a	CLIP-seq
MIRT2516099	hsa-miR-449b	CLIP-seq
MIRT2516100	hsa-miR-4511	CLIP-seq
MIRT2516101	hsa-miR-4539	CLIP-seq
MIRT2516102	hsa-miR-4632	CLIP-seq
MIRT935843	hsa-miR-4642	CLIP-seq
MIRT2516103	hsa-miR-4650-5p	CLIP-seq
MIRT2516104	hsa-miR-4651	CLIP-seq
MIRT2516105	hsa-miR-4664-5p	CLIP-seq
MIRT2212438	hsa-miR-4685-5p	CLIP-seq
MIRT935844	hsa-miR-4695-5p	CLIP-seq
MIRT935817	hsa-miR-4698	CLIP-seq
MIRT2212439	hsa-miR-4701-5p	CLIP-seq
MIRT2516106	hsa-miR-4718	CLIP-seq
MIRT935845	hsa-miR-4719	CLIP-seq
MIRT2516107	hsa-miR-4720-5p	CLIP-seq
MIRT935819	hsa-miR-4726-3p	CLIP-seq
MIRT2516108	hsa-miR-4733-5p	CLIP-seq
MIRT2516109	hsa-miR-4738-5p	CLIP-seq
MIRT2516110	hsa-miR-4745-5p	CLIP-seq
MIRT935846	hsa-miR-4749-3p	CLIP-seq
MIRT2516111	hsa-miR-4758-5p	CLIP-seq
MIRT2516112	hsa-miR-4761-3p	CLIP-seq
MIRT935847	hsa-miR-4763-3p	CLIP-seq
MIRT2516113	hsa-miR-4786-5p	CLIP-seq
MIRT2516114	hsa-miR-4797-5p	CLIP-seq
MIRT2516115	hsa-miR-4799-3p	CLIP-seq
MIRT2516116	hsa-miR-491-5p	CLIP-seq
MIRT2516117	hsa-miR-499-5p	CLIP-seq
MIRT2212441	hsa-miR-509-3p	CLIP-seq
MIRT2516118	hsa-miR-548b-3p	CLIP-seq
MIRT2212442	hsa-miR-548s	CLIP-seq
MIRT935848	hsa-miR-570	CLIP-seq
MIRT2212443	hsa-miR-588	CLIP-seq
MIRT2516119	hsa-miR-608	CLIP-seq
MIRT935849	hsa-miR-612	CLIP-seq
MIRT935850	hsa-miR-628-5p	CLIP-seq
MIRT2516120	hsa-miR-648	CLIP-seq
MIRT935851	hsa-miR-650	CLIP-seq
MIRT2516121	hsa-miR-759	CLIP-seq
MIRT2516122	hsa-miR-769-5p	CLIP-seq
MIRT2516123	hsa-miR-939	CLIP-seq
MIRT2516124	hsa-miR-942	CLIP-seq
MIRT935829	hsa-miR-98	CLIP-seq
MIRT2516113	hsa-miR-4786-5p	CLIP-seq
MIRT2516122	hsa-miR-769-5p	CLIP-seq
MIRT935796	hsa-let-7a	CLIP-seq
MIRT935797	hsa-let-7b	CLIP-seq
MIRT935798	hsa-let-7c	CLIP-seq
MIRT935799	hsa-let-7d	CLIP-seq
MIRT935800	hsa-let-7e	CLIP-seq
MIRT935801	hsa-let-7f	CLIP-seq
MIRT935802	hsa-let-7g	CLIP-seq
MIRT935803	hsa-let-7i	CLIP-seq
MIRT935830	hsa-miR-1207-5p	CLIP-seq
MIRT2516076	hsa-miR-1250	CLIP-seq
MIRT935832	hsa-miR-1285	CLIP-seq
MIRT2516077	hsa-miR-1324	CLIP-seq
MIRT2516078	hsa-miR-140-3p	CLIP-seq
MIRT935833	hsa-miR-1913	CLIP-seq
MIRT935805	hsa-miR-202	CLIP-seq
MIRT2516080	hsa-miR-203	CLIP-seq
MIRT2516081	hsa-miR-2355-5p	CLIP-seq
MIRT1976989	hsa-miR-3064-3p	CLIP-seq
MIRT2516082	hsa-miR-3150a-3p	CLIP-seq
MIRT935835	hsa-miR-3160-5p	CLIP-seq
MIRT2516083	hsa-miR-3175	CLIP-seq
MIRT2516084	hsa-miR-3186-5p	CLIP-seq
MIRT2212434	hsa-miR-3187-3p	CLIP-seq
MIRT935836	hsa-miR-3187-5p	CLIP-seq
MIRT935837	hsa-miR-324-3p	CLIP-seq
MIRT2516085	hsa-miR-324-5p	CLIP-seq
MIRT2516086	hsa-miR-342-5p	CLIP-seq
MIRT2516087	hsa-miR-34a	CLIP-seq
MIRT2516088	hsa-miR-34c-5p	CLIP-seq
MIRT935838	hsa-miR-3612	CLIP-seq
MIRT2516089	hsa-miR-3679-3p	CLIP-seq
MIRT2516090	hsa-miR-371b-3p	CLIP-seq
MIRT2516092	hsa-miR-4286	CLIP-seq
MIRT935839	hsa-miR-4292	CLIP-seq
MIRT2516093	hsa-miR-4302	CLIP-seq
MIRT2516094	hsa-miR-4432	CLIP-seq
MIRT2212436	hsa-miR-4435	CLIP-seq
MIRT2212437	hsa-miR-4436b-3p	CLIP-seq
MIRT935840	hsa-miR-4459	CLIP-seq
MIRT2516095	hsa-miR-4481	CLIP-seq
MIRT2516096	hsa-miR-4484	CLIP-seq
MIRT2516097	hsa-miR-4499	CLIP-seq
MIRT2516098	hsa-miR-449a	CLIP-seq
MIRT2516099	hsa-miR-449b	CLIP-seq
MIRT2516100	hsa-miR-4511	CLIP-seq
MIRT2516101	hsa-miR-4539	CLIP-seq
MIRT2516102	hsa-miR-4632	CLIP-seq
MIRT935843	hsa-miR-4642	CLIP-seq
MIRT2516104	hsa-miR-4651	CLIP-seq
MIRT2516105	hsa-miR-4664-5p	CLIP-seq
MIRT2212438	hsa-miR-4685-5p	CLIP-seq
MIRT935844	hsa-miR-4695-5p	CLIP-seq
MIRT935817	hsa-miR-4698	CLIP-seq
MIRT2212439	hsa-miR-4701-5p	CLIP-seq
MIRT2516106	hsa-miR-4718	CLIP-seq
MIRT935845	hsa-miR-4719	CLIP-seq
MIRT2516107	hsa-miR-4720-5p	CLIP-seq
MIRT935819	hsa-miR-4726-3p	CLIP-seq
MIRT2516108	hsa-miR-4733-5p	CLIP-seq
MIRT2516109	hsa-miR-4738-5p	CLIP-seq
MIRT2516110	hsa-miR-4745-5p	CLIP-seq
MIRT935846	hsa-miR-4749-3p	CLIP-seq
MIRT2516111	hsa-miR-4758-5p	CLIP-seq
MIRT2516112	hsa-miR-4761-3p	CLIP-seq
MIRT935847	hsa-miR-4763-3p	CLIP-seq
MIRT2516113	hsa-miR-4786-5p	CLIP-seq
MIRT2516114	hsa-miR-4797-5p	CLIP-seq
MIRT2516115	hsa-miR-4799-3p	CLIP-seq
MIRT2516116	hsa-miR-491-5p	CLIP-seq
MIRT2516117	hsa-miR-499-5p	CLIP-seq
MIRT2212441	hsa-miR-509-3p	CLIP-seq
MIRT2516118	hsa-miR-548b-3p	CLIP-seq
MIRT2212442	hsa-miR-548s	CLIP-seq
MIRT935848	hsa-miR-570	CLIP-seq
MIRT2212443	hsa-miR-588	CLIP-seq
MIRT2516119	hsa-miR-608	CLIP-seq
MIRT935849	hsa-miR-612	CLIP-seq
MIRT935850	hsa-miR-628-5p	CLIP-seq
MIRT2516120	hsa-miR-648	CLIP-seq
MIRT935851	hsa-miR-650	CLIP-seq
MIRT2516121	hsa-miR-759	CLIP-seq
MIRT2516122	hsa-miR-769-5p	CLIP-seq
MIRT2516123	hsa-miR-939	CLIP-seq
MIRT2516124	hsa-miR-942	CLIP-seq
MIRT935829	hsa-miR-98	CLIP-seq

Show/Hide all (27)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	11140638, 11604410, 11801603, 12559088, 15200957, 15628841, 16282325, 16729033, 19153467, 19667203, 21185211, 21536684, 21695558, 22465666, 23251006, 23479728, 25416956, 26871637, 32296183, 33961781
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IBA
GO:0005739	Component	Mitochondrion	IDA	28288130
GO:0005739	Component	Mitochondrion	IEA
GO:0005739	Component	Mitochondrion	TAS	10929711
GO:0005758	Component	Mitochondrial intermembrane space	TAS	18309324
GO:0005829	Component	Cytosol	IDA	28288130
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006915	Process	Apoptotic process	IEA
GO:0006915	Process	Apoptotic process	TAS	10929712
GO:0008625	Process	Extrinsic apoptotic signaling pathway via death domain receptors	TAS	10950947
GO:0008631	Process	Intrinsic apoptotic signaling pathway in response to oxidative stress	IBA
GO:0008631	Process	Intrinsic apoptotic signaling pathway in response to oxidative stress	IEA
GO:0009898	Component	Cytoplasmic side of plasma membrane	IEA
GO:0009898	Component	Cytoplasmic side of plasma membrane	ISS
GO:0035631	Component	CD40 receptor complex	IEA
GO:0035631	Component	CD40 receptor complex	ISS
GO:0043065	Process	Positive regulation of apoptotic process	IEA
GO:0043065	Process	Positive regulation of apoptotic process	TAS	18309324
GO:0051402	Process	Neuron apoptotic process	IBA
GO:0051402	Process	Neuron apoptotic process	IEA
GO:0097190	Process	Apoptotic signaling pathway	IMP	10972280
GO:0097193	Process	Intrinsic apoptotic signaling pathway	IEA
GO:0097193	Process	Intrinsic apoptotic signaling pathway	TAS	18309324

MIM	HGNC	e!Ensembl
605219	21528	ENSG00000184047

Q9NR28

Protein name

Diablo IAP-binding mitochondrial protein (Diablo homolog, mitochondrial) (Direct IAP-binding protein with low pI) (Second mitochondria-derived activator of caspases) (SMAC) [Cleaved into: Diablo IAP-binding mitochondrial protein, cleaved form]

Protein function

Promotes apoptosis by activating caspases in the cytochrome c/Apaf-1/caspase-9 pathway. Acts by opposing the inhibitory activity of inhibitor of apoptosis proteins (IAP). Inhibits the activity of BIRC6/BRUCE by inhibiting its binding to caspases

PDB

1FEW , 1G3F , 1G73 , 1OXQ , 1TW6 , 1XB0 , 1XB1 , 3D9U , 3UIH , 3UIJ , 4TX5 , 6JX6 , 8ATO , 8AUW , 8E2I , 8E2J

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF09057	Smac_DIABLO	9 → 239	Second Mitochondria-derived Activator of Caspases	Domain

Tissue specificity

TISSUE SPECIFICITY: Ubiquitously expressed with highest expression in testis. Expression is also high in heart, liver, kidney, spleen, prostate and ovary. Low in brain, lung, thymus and peripheral blood leukocytes. Isoform 3 is ubiquitously expressed. {EC

Sequence

MAALKSWLSRSVTSFFRYRQCLCVPVVANFKKRCFSELIRPWHKTVTIGFGVTLCAVPIA
QKSEPHSLSSEALMRRAVSLVTDSTSTFLSQTTYALIEAITEYTKAVYTLTSLYRQYTSL
LGKMNSEEEDEVWQVIIGARAEMTSKHQEYLKLETTWMTAVGLSEMAAEAAYQTGADQAS
ITARNHIQLVKLQVEEVHQLSRKAETKLAEAQIEELRQKTQEEGEERAESEQEAYLRED

Sequence length

239

Interactions

View interactions

	KEGG		Reactome
	Apoptosis Apoptosis - multiple species		Release of apoptotic factors from the mitochondria SMAC (DIABLO) binds to IAPs SMAC(DIABLO)-mediated dissociation of IAP:caspase complexes SMAC, XIAP-regulated apoptotic response Regulation of the apoptosome activity

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Autosomal dominant nonsyndromic hearing loss 64	Likely pathogenic	rs2547123498, rs1954260410	RCV004585113 RCV004585114	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (16)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
AUTOSOMAL DOMINANT ISOLATED SENSORINEURAL DEAFNESS TYPE DFNA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autosomal dominant nonsyndromic hearing loss	Uncertain significance	ClinVar CTD	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
BRAIN ISCHEMIA	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEAFNESS, AUTOSOMAL DOMINANT 64	—	CTD, Disgenet, HPO CTD, Disgenet, HPO CTD, Disgenet, HPO	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABLO-related disorder	Likely benign; Conflicting classifications of pathogenicity; Benign; Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABLO-Related Hearing Loss	not provided	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hearing impairment	Uncertain significance	ClinVar Disgenet	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
HUNTINGTON DISEASE	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of urinary bladder	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS OF HIP	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, HIP	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SENSORINEURAL HEARING LOSS OF BILATERAL EARS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (132)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma	Adenocarcinoma	BEFREE	17471152		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenocortical carcinoma	Adrenocortical carcinoma	BEFREE	28030838		★★★★★ ★☆☆☆☆ Found in Text Mining only
Agenesis of corpus callosum	Agenesis Of Corpus Callosum	BEFREE	28030838		★★★★★ ★☆☆☆☆ Found in Text Mining only
Akinetic-Rigid Variant of Huntington Disease	Akinetic-Rigid Variant Of Huntington Disease	CTD_human_DG	12930891		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aplasia Cutis Congenita	Aplasia Cutis Congenita	BEFREE	28030838		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	28694700		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autosomal dominant non-syndromic sensorineural deafness type DFNA	Non-Syndromic Sensorineural Deafness	Orphanet			★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	29715109		★★★★★ ★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	27431913	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Cerebral Ischemia	CTD_human_DG	11756504		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Carcinoma	Breast Carcinoma	BEFREE	17666167, 18590557, 22161156		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	18590557, 21645409, 25006666, 26662313, 28460471, 29895124, 33239070, 33492282, 33770100, 35007560	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	33971465	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	15560849, 31356194	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	17471152		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal	Ductal carcinoma	Pubtator	21645409	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	17997990	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	15010875, 21204765		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	28852723	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	15328523, 17922292	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	17067390	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	15541727, 18029193, 25577253		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	Pubtator	28682901	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Hypoxia-Ischemia	Cerebral Hypoxia-Ischemia	BEFREE	29192254		★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	15740652, 17067390, 29113168		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervical Intraepithelial Neoplasia	Cervical Intraepithelial Neoplasia	BEFREE	29113168		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	15740652, 17067390, 29113168		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	26775704		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	37513508	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chromosome 11p11.2 Deletion Syndrome	11p11.2 Deletion Syndrome	BEFREE	31305346		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic rhinosinusitis with nasal polyps	Rhinosinusitis With Nasal Polyps	BEFREE	25238746		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	22751125		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	16998592	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	LHGDN	17603079, 17630921		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	22751125		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	28476895		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	15557007, 23038270, 25198428, 26383618	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	16484020, 19148507		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	15572731		★★★★★ ★☆☆☆☆ Found in Text Mining only
DEAFNESS, AUTOSOMAL DOMINANT 64	Deafness	UNIPROT_DG	21722859		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEAFNESS, AUTOSOMAL DOMINANT 64	Deafness	GENOMICS_ENGLAND_DG	23510774, 26969326		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEAFNESS, AUTOSOMAL DOMINANT 64	Deafness	CTD_human_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEAFNESS, AUTOSOMAL DOMINANT 64	Deafness	CLINVAR_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	27276707, 31830245		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	21478115	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsies Myoclonic	Myoclonic epilepsy	Pubtator	22152093	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	18029193		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	21676925, 25673090		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	21676925, 25673090		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	23538445, 26152356	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	26152356, 29236891		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	26379193	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	26152356, 29236891		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	LHGDN	12118245		★★★★★ ★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	29296793		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	30836448		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	16868249	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	LHGDN	16949641		★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	CTD_human_DG	12930891		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Huntington Disease, Late Onset	Huntington Disease	CTD_human_DG	12930891		★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile Huntington Disease	Huntington Disease	CTD_human_DG	12930891		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	11964312, 24030154, 27385100	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	24526787	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	20061022		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	17997990, 22530834, 24771354, 25214410, 30459627		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	22530834		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	24681884, 30016782, 34008478	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	31362927		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	12118245		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	17666167, 22161156		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	21676925, 25673090		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	15010875, 21204765		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	15541727, 25577253		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	28440486, 30365143		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	17718901		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	12118245, 14612497, 15572731, 16091752, 17298543, 18029193, 18822137, 20431601, 22161156, 22379024, 23857156, 24194568, 27469115, 28424988, 28476895 View all (7 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	15740652, 17067390, 29113168		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	22751125		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	17666167		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	11585775, 12771938		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	11801603, 20461078, 22723988, 32054850, 35941108	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	19360292		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	16868249	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	23348591	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	LHGDN	12665525		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	12665525, 15070698, 27494845	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	24481531		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	21567097		★★★★★ ★☆☆☆☆ Found in Text Mining only
Necrotizing enterocolitis in fetus OR newborn	Necrotizing Enterocolitis	BEFREE	20580721		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	15328523, 15560849, 16091752, 17967504, 18822137, 20056675, 20431601, 21676925, 22379024, 22751125, 25577253, 27166192, 28030838, 28476895, 28649853 View all (4 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	12118245, 15544495, 16288043, 20444257, 22788920		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	15632181, 20444257, 22788920, 26575016, 27655666	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	33558564	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	29311118, 30894749		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nonsyndromic Deafness	Nonsyndromic Deafness	CLINGEN_DG	10929711, 21722859		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis of hip	Osteoarthritis Of Hip	CTD_human_DG	30664745		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteosarcoma	Osteosarcoma	BEFREE	16211087, 29061790		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	15541727, 25577253		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	25577253		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	22052903, 22558117, 28852723, 35281523	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	29226858	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	28440486, 30365143		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	28482903		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	22320973, 34462421	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
PEELING SKIN SYNDROME	Peeling Skin Syndrome	BEFREE	31305346		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	31749151, 31830245		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	23906015		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic hyperplasia	Pubtator	37378942	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	17718901		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	19275204, 19895686	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	37378942	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	15328523, 15572731		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	LHGDN	17922292		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdoid Tumor	Rhabdoid tumor	Pubtator	35613525	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	Pubtator	36980247	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	BEFREE	17298543		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sensorineural Hearing Loss (disorder)	Hearing Loss	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	LHGDN	14560006, 18401527		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	14560006, 18401527	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	17067390		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	21676925		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	31517839, 33108350	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	38490621	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	21242120, 29467909		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	15609401	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	31305346		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	31973107	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	27276707, 35631261, 37093683	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	28187446		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	20814238, 22517918	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	22218530	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	15560849, 17067390	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

DIABLO (diablo IAP-binding mitochondrial protein)