ERO1B (endoplasmic reticulum oxidoreductase 1 beta)

Gene

• Entrez ID: 56605
• Gene name: Endoplasmic reticulum oxidoreductase 1 beta
• Gene symbol: ERO1B
• Synonyms (NCBI Gene): ERO1LB, Ero1beta
• Chromosome: 1
• Chromosome location: 1q42.3

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT440709	hsa-miR-376a-3p	HITS-CLIP	24374217
MIRT440708	hsa-miR-432-5p	HITS-CLIP	24374217
MIRT440706	hsa-miR-1185-2-3p	HITS-CLIP	24374217
MIRT440707	hsa-miR-376c-3p	HITS-CLIP	24374217
MIRT440705	hsa-miR-1185-1-3p	HITS-CLIP	24374217
MIRT440709	hsa-miR-376a-3p	HITS-CLIP	24374217
MIRT440708	hsa-miR-432-5p	HITS-CLIP	24374217
MIRT440706	hsa-miR-1185-2-3p	HITS-CLIP	24374217
MIRT440707	hsa-miR-376c-3p	HITS-CLIP	24374217
MIRT440705	hsa-miR-1185-1-3p	HITS-CLIP	24374217

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	20802462
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005783	Component	Endoplasmic reticulum	TAS	10818100
GO:0005788	Component	Endoplasmic reticulum lumen	IEA
GO:0005788	Component	Endoplasmic reticulum lumen	TAS
GO:0005789	Component	Endoplasmic reticulum membrane	IBA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0006457	Process	Protein folding	TAS	10818100
GO:0006888	Process	Endoplasmic reticulum to Golgi vesicle-mediated transport	IEA
GO:0015035	Function	Protein-disulfide reductase activity	EXP	11707400, 16407158, 21091435
GO:0015035	Function	Protein-disulfide reductase activity	IBA
GO:0015035	Function	Protein-disulfide reductase activity	IEA
GO:0015036	Function	Disulfide oxidoreductase activity	IEA
GO:0016020	Component	Membrane	IEA
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0016491	Function	Oxidoreductase activity	NAS	10818100
GO:0016972	Function	Thiol oxidase activity	IDA	21091435
GO:0016972	Function	Thiol oxidase activity	IEA
GO:0030070	Process	Insulin processing	IEA
GO:0030070	Process	Insulin processing	TAS
GO:0030198	Process	Extracellular matrix organization	IEA
GO:0034975	Process	Protein folding in endoplasmic reticulum	IBA
GO:0034975	Process	Protein folding in endoplasmic reticulum	IDA	21091435
GO:0034975	Process	Protein folding in endoplasmic reticulum	IEA
GO:0042593	Process	Glucose homeostasis	IEA
GO:0045454	Process	Cell redox homeostasis	IEA
GO:0051082	Function	Unfolded protein binding	NAS	10818100
GO:0051604	Process	Protein maturation	IEA
GO:0071949	Function	FAD binding	IEA

Other IDs

• MIM: 615437
• HGNC: 14355
• e!Ensembl: ENSG00000086619

Protein

• UniProt ID: Q86YB8
• Protein name: ERO1-like protein beta (ERO1-L-beta) (EC 1.8.4.-) (Endoplasmic reticulum oxidoreductase beta) (Endoplasmic reticulum oxidoreductin-1-like protein B) (Oxidoreductin-1-L-beta)
• Protein function: Oxidoreductase involved in disulfide bond formation in the endoplasmic reticulum. Efficiently reoxidizes P4HB/PDI, the enzyme catalyzing protein disulfide formation, in order to allow P4HB to sustain additional rounds of disulfide formation. Oth
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF04137	ERO1	56 → 456	Endoplasmic Reticulum Oxidoreductin 1 (ERO1)	Family

• Tissue specificity: TISSUE SPECIFICITY: Highly expressed in the digestive tract, including the duodenum and lower digestive tract. In the stomach, highly expressed in enzyme-producing chief cells (at protein level). In the pancreas, expressed in islets of Langerhans and, at
• Sequence:

  MSQGVRRAGAGQGVAAAVQLLVTLSFLRSVVEAQVTGVLDDCLCDIDSIDNFNTYKIFPK
  IKKLQERDYFRYYKVNLKRPCPFWAEDGHCSIKDCHVEPCPESKIPVGIKAGHSNKYLKM
  ANNTKELEDCEQANKLGAINSTLSNQSKEAFIDWARYDDSRDHFCELDDERSPAAQYVDL
  LLNPERYTGYKGTSAWRVWNSIYEENCFKPRSVYRPLNPLAPSRGEDDGESFYTWLEGLC
  LEKRVFYKLISGLHASINLHLCANYLLEETWGKPSWGPNIKEFKHRFDPVETKGEGPRRL
  KNLYFLYLIELRALSKVAPYFERSIVDLYTGNAEEDADTKTLLLNIFQDTKSFPMHFDEK
  SMFAGDKKGAKSLKEEFRLHFKNISRIMDCVGCDKCRLWGKLQTQGLGTALKILFSEKEI
  QKLPENSPSKGFQLTRQEIVALLNAFGRLSTSIRDLQNFKVLLQHSR

• Sequence length: 467

Pathways

KEGG:

Protein processing in endoplasmic reticulum

Reactome:

Insulin processing

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL CATARACT	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Developmental cataract	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PANCREATIC CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UPPER AERODIGESTIVE TRACT NEOPLASM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Asthma	Asthma	BEFREE	18395550		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	36109769	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	35568702	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	28177904		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	28177904		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pancreatic carcinoma	Pancreatic carcinoma	GWASCAT_DG	28470677		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	28177904	Associate	★☆☆☆☆ Found in Text Mining only