Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
Entrez ID	5655
Gene name	Kallikrein related peptidase 10
Gene symbol	KLK10
Synonyms (NCBI Gene)	NES1PRSSL1
Chromosome	19
Chromosome location	19q13.41
Summary	Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one

188

Show/Hide all (188)

miRTarBase ID	miRNA	Experiments	Reference
MIRT000455	hsa-let-7f-5p	qRT-PCRLuciferase reporter assay	20354523
MIRT000454	hsa-miR-224-5p	qRT-PCRLuciferase reporter assay	20354523
MIRT000455	hsa-let-7f-5p	ELISALuciferase reporter assayqRT-PCR	18627289
MIRT019672	hsa-miR-375	Microarray	20215506
MIRT569877	hsa-miR-2392	PAR-CLIP	20371350
MIRT569876	hsa-miR-4667-5p	PAR-CLIP	20371350
MIRT569874	hsa-miR-4700-5p	PAR-CLIP	20371350
MIRT569875	hsa-miR-8089	PAR-CLIP	20371350
MIRT569873	hsa-miR-3605-5p	PAR-CLIP	20371350
MIRT569872	hsa-miR-4534	PAR-CLIP	20371350
MIRT569871	hsa-miR-8082	PAR-CLIP	20371350
MIRT569870	hsa-miR-6077	PAR-CLIP	20371350
MIRT569869	hsa-miR-766-5p	PAR-CLIP	20371350
MIRT569868	hsa-miR-7106-5p	PAR-CLIP	20371350
MIRT569867	hsa-miR-3175	PAR-CLIP	20371350
MIRT569866	hsa-miR-1343-5p	PAR-CLIP	20371350
MIRT569865	hsa-miR-939-5p	PAR-CLIP	20371350
MIRT569863	hsa-miR-6825-5p	PAR-CLIP	20371350
MIRT569864	hsa-miR-3150a-3p	PAR-CLIP	20371350
MIRT569862	hsa-miR-6763-5p	PAR-CLIP	20371350
MIRT569861	hsa-miR-6880-5p	PAR-CLIP	20371350
MIRT474394	hsa-miR-140-5p	PAR-CLIP	23592263
MIRT474393	hsa-miR-194-3p	PAR-CLIP	23592263
MIRT474392	hsa-miR-1252-5p	PAR-CLIP	23592263
MIRT474391	hsa-miR-4795-5p	PAR-CLIP	23592263
MIRT474390	hsa-miR-1253	PAR-CLIP	23592263
MIRT474389	hsa-miR-6770-5p	PAR-CLIP	23592263
MIRT474387	hsa-miR-143-3p	PAR-CLIP	23592263
MIRT474388	hsa-miR-4770	PAR-CLIP	23592263
MIRT474386	hsa-miR-6088	PAR-CLIP	23592263
MIRT474385	hsa-miR-4261	PAR-CLIP	23592263
MIRT474384	hsa-miR-6878-5p	PAR-CLIP	23592263
MIRT474383	hsa-miR-6731-5p	PAR-CLIP	23592263
MIRT474382	hsa-miR-8085	PAR-CLIP	23592263
MIRT474381	hsa-miR-1233-5p	PAR-CLIP	23592263
MIRT474380	hsa-miR-6778-5p	PAR-CLIP	23592263
MIRT474379	hsa-miR-30c-1-3p	PAR-CLIP	23592263
MIRT474378	hsa-miR-30c-2-3p	PAR-CLIP	23592263
MIRT474376	hsa-miR-6788-5p	PAR-CLIP	23592263
MIRT569877	hsa-miR-2392	PAR-CLIP	20371350
MIRT569876	hsa-miR-4667-5p	PAR-CLIP	20371350
MIRT569874	hsa-miR-4700-5p	PAR-CLIP	20371350
MIRT569875	hsa-miR-8089	PAR-CLIP	20371350
MIRT569873	hsa-miR-3605-5p	PAR-CLIP	20371350
MIRT569872	hsa-miR-4534	PAR-CLIP	20371350
MIRT569871	hsa-miR-8082	PAR-CLIP	20371350
MIRT569870	hsa-miR-6077	PAR-CLIP	20371350
MIRT569869	hsa-miR-766-5p	PAR-CLIP	20371350
MIRT569868	hsa-miR-7106-5p	PAR-CLIP	20371350
MIRT569867	hsa-miR-3175	PAR-CLIP	20371350
MIRT569866	hsa-miR-1343-5p	PAR-CLIP	20371350
MIRT569865	hsa-miR-939-5p	PAR-CLIP	20371350
MIRT569863	hsa-miR-6825-5p	PAR-CLIP	20371350
MIRT569864	hsa-miR-3150a-3p	PAR-CLIP	20371350
MIRT569862	hsa-miR-6763-5p	PAR-CLIP	20371350
MIRT569861	hsa-miR-6880-5p	PAR-CLIP	20371350
MIRT474394	hsa-miR-140-5p	PAR-CLIP	23592263
MIRT474393	hsa-miR-194-3p	PAR-CLIP	23592263
MIRT474392	hsa-miR-1252-5p	PAR-CLIP	23592263
MIRT474391	hsa-miR-4795-5p	PAR-CLIP	23592263
MIRT474390	hsa-miR-1253	PAR-CLIP	23592263
MIRT474389	hsa-miR-6770-5p	PAR-CLIP	23592263
MIRT474387	hsa-miR-143-3p	PAR-CLIP	23592263
MIRT474388	hsa-miR-4770	PAR-CLIP	23592263
MIRT474386	hsa-miR-6088	PAR-CLIP	23592263
MIRT474385	hsa-miR-4261	PAR-CLIP	23592263
MIRT474384	hsa-miR-6878-5p	PAR-CLIP	23592263
MIRT474383	hsa-miR-6731-5p	PAR-CLIP	23592263
MIRT474382	hsa-miR-8085	PAR-CLIP	23592263
MIRT474381	hsa-miR-1233-5p	PAR-CLIP	23592263
MIRT474380	hsa-miR-6778-5p	PAR-CLIP	23592263
MIRT474379	hsa-miR-30c-1-3p	PAR-CLIP	23592263
MIRT474378	hsa-miR-30c-2-3p	PAR-CLIP	23592263
MIRT474376	hsa-miR-6788-5p	PAR-CLIP	23592263
MIRT1098964	hsa-miR-1254	CLIP-seq
MIRT1098965	hsa-miR-1262	CLIP-seq
MIRT1098966	hsa-miR-1293	CLIP-seq
MIRT1098967	hsa-miR-214	CLIP-seq
MIRT1098968	hsa-miR-216a	CLIP-seq
MIRT1098969	hsa-miR-3116	CLIP-seq
MIRT1098970	hsa-miR-3147	CLIP-seq
MIRT1098971	hsa-miR-3149	CLIP-seq
MIRT1098972	hsa-miR-342-3p	CLIP-seq
MIRT1098973	hsa-miR-3619-5p	CLIP-seq
MIRT1098974	hsa-miR-4291	CLIP-seq
MIRT1098975	hsa-miR-4425	CLIP-seq
MIRT1098976	hsa-miR-4483	CLIP-seq
MIRT1098977	hsa-miR-4694-5p	CLIP-seq
MIRT1098978	hsa-miR-4701-3p	CLIP-seq
MIRT1098979	hsa-miR-4715-3p	CLIP-seq
MIRT1098980	hsa-miR-4722-3p	CLIP-seq
MIRT1098981	hsa-miR-4722-5p	CLIP-seq
MIRT1098982	hsa-miR-4763-5p	CLIP-seq
MIRT1098983	hsa-miR-4782-5p	CLIP-seq
MIRT1098984	hsa-miR-4794	CLIP-seq
MIRT1098985	hsa-miR-582-3p	CLIP-seq
MIRT1098986	hsa-miR-661	CLIP-seq
MIRT1098987	hsa-miR-761	CLIP-seq
MIRT1098988	hsa-miR-922	CLIP-seq
MIRT1098989	hsa-miR-1245b-3p	CLIP-seq
MIRT1098990	hsa-miR-1273f	CLIP-seq
MIRT1098991	hsa-miR-127-5p	CLIP-seq
MIRT1098992	hsa-miR-197	CLIP-seq
MIRT1098993	hsa-miR-3074-5p	CLIP-seq
MIRT1098994	hsa-miR-3167	CLIP-seq
MIRT1098995	hsa-miR-3187-3p	CLIP-seq
MIRT1098996	hsa-miR-3614-3p	CLIP-seq
MIRT1098997	hsa-miR-3663-5p	CLIP-seq
MIRT1098998	hsa-miR-3678-3p	CLIP-seq
MIRT1098999	hsa-miR-3915	CLIP-seq
MIRT1099000	hsa-miR-3928	CLIP-seq
MIRT1099001	hsa-miR-412	CLIP-seq
MIRT1099002	hsa-miR-4435	CLIP-seq
MIRT1099003	hsa-miR-4496	CLIP-seq
MIRT1099004	hsa-miR-450b-5p	CLIP-seq
MIRT1099005	hsa-miR-4640-3p	CLIP-seq
MIRT1099006	hsa-miR-4701-5p	CLIP-seq
MIRT1098979	hsa-miR-4715-3p	CLIP-seq
MIRT1099007	hsa-miR-4738-3p	CLIP-seq
MIRT1099008	hsa-miR-4766-5p	CLIP-seq
MIRT1099009	hsa-miR-488	CLIP-seq
MIRT1099010	hsa-miR-495	CLIP-seq
MIRT1099011	hsa-miR-507	CLIP-seq
MIRT1099012	hsa-miR-5096	CLIP-seq
MIRT1099013	hsa-miR-548s	CLIP-seq
MIRT1099014	hsa-miR-557	CLIP-seq
MIRT1099015	hsa-miR-588	CLIP-seq
MIRT1099016	hsa-miR-876-5p	CLIP-seq
MIRT1098964	hsa-miR-1254	CLIP-seq
MIRT1098969	hsa-miR-3116	CLIP-seq
MIRT1098971	hsa-miR-3149	CLIP-seq
MIRT1098979	hsa-miR-4715-3p	CLIP-seq
MIRT1098980	hsa-miR-4722-3p	CLIP-seq
MIRT1098982	hsa-miR-4763-5p	CLIP-seq
MIRT1098984	hsa-miR-4794	CLIP-seq
MIRT1098986	hsa-miR-661	CLIP-seq
MIRT2389985	hsa-miR-1184	CLIP-seq
MIRT2389986	hsa-miR-1205	CLIP-seq
MIRT2389987	hsa-miR-1275	CLIP-seq
MIRT2389988	hsa-miR-150	CLIP-seq
MIRT2389989	hsa-miR-1909	CLIP-seq
MIRT2389990	hsa-miR-3144-5p	CLIP-seq
MIRT2389991	hsa-miR-3158-5p	CLIP-seq
MIRT2389992	hsa-miR-3194-3p	CLIP-seq
MIRT2389993	hsa-miR-3649	CLIP-seq
MIRT2389994	hsa-miR-4289	CLIP-seq
MIRT2389995	hsa-miR-4437	CLIP-seq
MIRT2389996	hsa-miR-4447	CLIP-seq
MIRT2389997	hsa-miR-4472	CLIP-seq
MIRT2389998	hsa-miR-4525	CLIP-seq
MIRT2389999	hsa-miR-4665-5p	CLIP-seq
MIRT2390000	hsa-miR-4674	CLIP-seq
MIRT2390001	hsa-miR-4723-5p	CLIP-seq
MIRT2390002	hsa-miR-625	CLIP-seq
MIRT2390003	hsa-miR-760	CLIP-seq
MIRT2452697	hsa-miR-1321	CLIP-seq
MIRT2452698	hsa-miR-3679-3p	CLIP-seq
MIRT2452699	hsa-miR-4257	CLIP-seq
MIRT2452700	hsa-miR-4419a	CLIP-seq
MIRT2452701	hsa-miR-4510	CLIP-seq
MIRT2452702	hsa-miR-4739	CLIP-seq
MIRT2452703	hsa-miR-4756-5p	CLIP-seq
MIRT2452697	hsa-miR-1321	CLIP-seq
MIRT2452698	hsa-miR-3679-3p	CLIP-seq
MIRT2452699	hsa-miR-4257	CLIP-seq
MIRT2452700	hsa-miR-4419a	CLIP-seq
MIRT2452701	hsa-miR-4510	CLIP-seq
MIRT2452702	hsa-miR-4739	CLIP-seq
MIRT2452703	hsa-miR-4756-5p	CLIP-seq
MIRT1098964	hsa-miR-1254	CLIP-seq
MIRT2559109	hsa-miR-1297	CLIP-seq
MIRT2559110	hsa-miR-1913	CLIP-seq
MIRT2559111	hsa-miR-26a	CLIP-seq
MIRT2559112	hsa-miR-26b	CLIP-seq
MIRT1098969	hsa-miR-3116	CLIP-seq
MIRT1098971	hsa-miR-3149	CLIP-seq
MIRT2559113	hsa-miR-324-3p	CLIP-seq
MIRT2559114	hsa-miR-4313	CLIP-seq
MIRT2559115	hsa-miR-4465	CLIP-seq
MIRT1098979	hsa-miR-4715-3p	CLIP-seq
MIRT1098984	hsa-miR-4794	CLIP-seq
MIRT1098986	hsa-miR-661	CLIP-seq
MIRT1098964	hsa-miR-1254	CLIP-seq
MIRT1098969	hsa-miR-3116	CLIP-seq
MIRT1098971	hsa-miR-3149	CLIP-seq
MIRT1098979	hsa-miR-4715-3p	CLIP-seq
MIRT1098984	hsa-miR-4794	CLIP-seq
MIRT1098986	hsa-miR-661	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
MBD2	Unknown	21693597

Show/Hide all (12)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004252	Function	Serine-type endopeptidase activity	IBA
GO:0004252	Function	Serine-type endopeptidase activity	IEA
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS	8764136
GO:0005615	Component	Extracellular space	IBA
GO:0006508	Process	Proteolysis	IEA
GO:0008233	Function	Peptidase activity	IEA
GO:0008236	Function	Serine-type peptidase activity	IEA
GO:0008236	Function	Serine-type peptidase activity	TAS	8764136
GO:0016787	Function	Hydrolase activity	IEA
GO:0030141	Component	Secretory granule	IBA
GO:0051604	Process	Protein maturation	IBA

MIM	HGNC	e!Ensembl
602673	6358	ENSG00000129451

O43240

Protein name

Kallikrein-10 (EC 3.4.21.-) (Normal epithelial cell-specific 1) (Protease serine-like 1)

Protein function

Has a tumor-suppressor role for NES1 in breast and prostate cancer.

PDB

5LPE , 5LPF

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00089	Trypsin	47 → 269	Trypsin	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in breast, ovary and prostate.

Sequence

MRAPHLHLSAASGARALAKLLPLLMAQLWAAEAALLPQNDTRLDPEAYGSPCARGSQPWQ
VSLFNGLSFHCAGVLVDQSWVLTAAHCGNKPLWARVGDDHLLLLQGEQLRRTTRSVVHPK
YHQGSGPILPRRTDEHDLMLLKLARPVVLGPRVRALQLPYRCAQPGDQCQVAGWGTTAAR
RVKYNKGLTCSSITILSPKECEVFYPGVVTNNMICAGLDRGQDPCQSDSGGPLVCDETLQ
GILSWGVYPCGSAQHPAVYTQICKYMSWINKVIRSN

Sequence length

276

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BREAST NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STOMACH NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (85)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
ACTH-Secreting Pituitary Adenoma	Pituitary adenoma	BEFREE	25517869		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	18854834		★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	18854834, 29621546		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	10675891, 10810385, 11461080, 11691827, 11705853, 12087468, 12633763, 16254462, 16800732, 17937626, 19150938, 25503118, 26616394, 27825132		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	16800735		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	11461080, 12087468, 14710225, 16103744, 16254462	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	17656355, 18485221, 18515984, 19150938, 20086175, 27825132	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma in Situ	Carcinoma in situ	Pubtator	11461080	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	18854834, 34957503	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	36610378	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	16340244	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	12821340, 12876620, 20686372, 23499583		★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	29807015		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	29807015		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	19760608		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	33985413	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	16928223, 21487810, 23499583		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	15015574	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	19367279, 21487810, 22437349, 31796117, 34911835, 35883559, 37938164, 37972446	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	20180642		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	LHGDN	14972646		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	26479703		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	26479703		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibroadenoma	Fibroadenoma	BEFREE	19150938		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal Neoplasms	BEFREE	26479703		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Diffuse Gastric Cancer	Gastric Cancer	CTD_human_DG	17182177		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypospadias	Hypospadias	Pubtator	32728162	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	BEFREE	11705853		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	35669967	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	19760608		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	19760608		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	24409072	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	10675891, 10810385, 11461080, 11691827, 11705853, 12087468, 12382187, 12633763, 16254462, 16800732, 16800735, 17937626, 19150938, 25503118, 26616394, 27825132 View all (1 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	16800735		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	26479703		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	16928223		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	12821340, 12876620, 20686372, 23499583		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	CTD_human_DG	20686372		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	15015574		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	11705853, 16103744, 16254462, 22874102, 23499583, 26616394		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	16103744, 16928223, 17182177, 18855978, 24409072, 28418926, 29231994		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	CTD_human_DG	17182177		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11461080, 11920956, 16103744, 20180809, 23413953, 23499583, 26479703, 29690914		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	29807015		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	16800735		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	11691827, 12087468, 19150938		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	12087468, 14696124, 18515984		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	16800735		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	16800735		★★★★★ ★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	CTD_human_DG	18539642		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	25153387		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10810385, 11461080, 11691827, 11920956, 12087468, 12382187, 12788170, 12821340, 12876620, 16928223, 17182177, 18855978, 20180809, 21255913, 21487810 View all (6 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	17823117	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	16800740, 20180809, 21255913		★★★★★ ★☆☆☆☆ Found in Text Mining only
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	BEFREE	12788170		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	12821340, 23499583		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	11920956		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	12876620, 20686372, 29690914		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	CTD_human_DG	20686372		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	12624183, 15305371, 16103744, 16557045, 19383346, 20181382, 20354523, 20686372, 29093164, 29095848, 29690914	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	16254462	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	15015574		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	18854834		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	15015574	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	34290570	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	Pubtator	16103744	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	30614796		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pituitary Diseases	Pituitary Diseases	BEFREE	25517869		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary neoplasm	Pubtator	25553760	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Kidney Diseases	Polycystic kidney disease	Pubtator	16103744	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	11705853, 22874102, 23499583, 26616394		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	16254462		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	22874102, 34089177	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	28621160	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	20180642		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	16800740		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	16928223, 17182177, 18855978, 24409072, 28418926, 29231994		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	17182177		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach Neoplasms	CTD_human_DG	17182177		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach neoplasms	Pubtator	18302799, 24409072, 28418926, 37868053	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	29767230	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	30614796	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	36716280	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Neoplasms	Uterine neoplasm	Pubtator	15785748	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Xeroderma Pigmentosum	Xeroderma pigmentosum	Pubtator	35974070	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

KLK10 (kallikrein related peptidase 10)