Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	5650
Gene name	Kallikrein related peptidase 7
Gene symbol	KLK7
Synonyms (NCBI Gene)	PRSS6SCCEhK7
Chromosome	19
Chromosome location	19q13.41
Summary	This gene encodes a member of the kallikrein subfamily of serine proteases. These enzymes have diverse physiological functions and many kallikrein genes are biomarkers for cancer. The encoded protein has chymotrypsin-like activity and plays a role in the

125

Show/Hide all (125)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018481	hsa-miR-335-5p	Microarray	18185580
MIRT1099074	hsa-miR-1293	CLIP-seq
MIRT1099075	hsa-miR-3122	CLIP-seq
MIRT1099076	hsa-miR-3165	CLIP-seq
MIRT1099077	hsa-miR-34b	CLIP-seq
MIRT1099078	hsa-miR-3614-5p	CLIP-seq
MIRT1099079	hsa-miR-3689a-3p	CLIP-seq
MIRT1099080	hsa-miR-3689c	CLIP-seq
MIRT1099081	hsa-miR-3913-5p	CLIP-seq
MIRT1099082	hsa-miR-4459	CLIP-seq
MIRT1099083	hsa-miR-4483	CLIP-seq
MIRT1099084	hsa-miR-4490	CLIP-seq
MIRT1099085	hsa-miR-4695-5p	CLIP-seq
MIRT1099086	hsa-miR-4728-5p	CLIP-seq
MIRT1099087	hsa-miR-4761-5p	CLIP-seq
MIRT1099088	hsa-miR-4774-5p	CLIP-seq
MIRT1099089	hsa-miR-658	CLIP-seq
MIRT1099090	hsa-miR-665	CLIP-seq
MIRT1099074	hsa-miR-1293	CLIP-seq
MIRT1099091	hsa-miR-24	CLIP-seq
MIRT1099092	hsa-miR-3120-5p	CLIP-seq
MIRT1099075	hsa-miR-3122	CLIP-seq
MIRT1099076	hsa-miR-3165	CLIP-seq
MIRT1099093	hsa-miR-3200-5p	CLIP-seq
MIRT1099077	hsa-miR-34b	CLIP-seq
MIRT1099078	hsa-miR-3614-5p	CLIP-seq
MIRT1099094	hsa-miR-3664-5p	CLIP-seq
MIRT1099079	hsa-miR-3689a-3p	CLIP-seq
MIRT1099080	hsa-miR-3689c	CLIP-seq
MIRT1099095	hsa-miR-371-5p	CLIP-seq
MIRT1099096	hsa-miR-371b-5p	CLIP-seq
MIRT1099081	hsa-miR-3913-5p	CLIP-seq
MIRT1099097	hsa-miR-3937	CLIP-seq
MIRT1099098	hsa-miR-4284	CLIP-seq
MIRT1099082	hsa-miR-4459	CLIP-seq
MIRT1099083	hsa-miR-4483	CLIP-seq
MIRT1099099	hsa-miR-4522	CLIP-seq
MIRT1099100	hsa-miR-4649-3p	CLIP-seq
MIRT1099086	hsa-miR-4728-5p	CLIP-seq
MIRT1099087	hsa-miR-4761-5p	CLIP-seq
MIRT1099090	hsa-miR-665	CLIP-seq
MIRT1099077	hsa-miR-34b	CLIP-seq
MIRT1099078	hsa-miR-3614-5p	CLIP-seq
MIRT1099079	hsa-miR-3689a-3p	CLIP-seq
MIRT1099080	hsa-miR-3689c	CLIP-seq
MIRT2026919	hsa-miR-3929	CLIP-seq
MIRT2026920	hsa-miR-4419b	CLIP-seq
MIRT2026921	hsa-miR-4478	CLIP-seq
MIRT1099086	hsa-miR-4728-5p	CLIP-seq
MIRT2026922	hsa-miR-485-5p	CLIP-seq
MIRT2026923	hsa-miR-890	CLIP-seq
MIRT2258155	hsa-miR-10a	CLIP-seq
MIRT2258156	hsa-miR-10b	CLIP-seq
MIRT2258157	hsa-miR-1251	CLIP-seq
MIRT1099074	hsa-miR-1293	CLIP-seq
MIRT1099075	hsa-miR-3122	CLIP-seq
MIRT1099076	hsa-miR-3165	CLIP-seq
MIRT1099093	hsa-miR-3200-5p	CLIP-seq
MIRT2258158	hsa-miR-325	CLIP-seq
MIRT2258159	hsa-miR-339-5p	CLIP-seq
MIRT1099079	hsa-miR-3689a-3p	CLIP-seq
MIRT1099080	hsa-miR-3689c	CLIP-seq
MIRT1099081	hsa-miR-3913-5p	CLIP-seq
MIRT1099097	hsa-miR-3937	CLIP-seq
MIRT2258160	hsa-miR-4421	CLIP-seq
MIRT1099083	hsa-miR-4483	CLIP-seq
MIRT1099100	hsa-miR-4649-3p	CLIP-seq
MIRT1099086	hsa-miR-4728-5p	CLIP-seq
MIRT1099087	hsa-miR-4761-5p	CLIP-seq
MIRT2258161	hsa-miR-548c-3p	CLIP-seq
MIRT2258162	hsa-miR-593	CLIP-seq
MIRT2258163	hsa-miR-628-3p	CLIP-seq
MIRT2258155	hsa-miR-10a	CLIP-seq
MIRT2258156	hsa-miR-10b	CLIP-seq
MIRT2258157	hsa-miR-1251	CLIP-seq
MIRT2258158	hsa-miR-325	CLIP-seq
MIRT2258159	hsa-miR-339-5p	CLIP-seq
MIRT2258160	hsa-miR-4421	CLIP-seq
MIRT2452704	hsa-miR-4731-3p	CLIP-seq
MIRT2452705	hsa-miR-4801	CLIP-seq
MIRT2258161	hsa-miR-548c-3p	CLIP-seq
MIRT2258162	hsa-miR-593	CLIP-seq
MIRT2258163	hsa-miR-628-3p	CLIP-seq
MIRT2258155	hsa-miR-10a	CLIP-seq
MIRT2258156	hsa-miR-10b	CLIP-seq
MIRT2258157	hsa-miR-1251	CLIP-seq
MIRT1099074	hsa-miR-1293	CLIP-seq
MIRT1099092	hsa-miR-3120-5p	CLIP-seq
MIRT1099075	hsa-miR-3122	CLIP-seq
MIRT1099076	hsa-miR-3165	CLIP-seq
MIRT1099093	hsa-miR-3200-5p	CLIP-seq
MIRT2258158	hsa-miR-325	CLIP-seq
MIRT2258159	hsa-miR-339-5p	CLIP-seq
MIRT1099094	hsa-miR-3664-5p	CLIP-seq
MIRT1099079	hsa-miR-3689a-3p	CLIP-seq
MIRT1099080	hsa-miR-3689c	CLIP-seq
MIRT1099095	hsa-miR-371-5p	CLIP-seq
MIRT1099096	hsa-miR-371b-5p	CLIP-seq
MIRT1099081	hsa-miR-3913-5p	CLIP-seq
MIRT1099097	hsa-miR-3937	CLIP-seq
MIRT2258160	hsa-miR-4421	CLIP-seq
MIRT1099083	hsa-miR-4483	CLIP-seq
MIRT1099099	hsa-miR-4522	CLIP-seq
MIRT1099100	hsa-miR-4649-3p	CLIP-seq
MIRT1099086	hsa-miR-4728-5p	CLIP-seq
MIRT1099087	hsa-miR-4761-5p	CLIP-seq
MIRT2258161	hsa-miR-548c-3p	CLIP-seq
MIRT2258162	hsa-miR-593	CLIP-seq
MIRT2258163	hsa-miR-628-3p	CLIP-seq
MIRT1099074	hsa-miR-1293	CLIP-seq
MIRT1099092	hsa-miR-3120-5p	CLIP-seq
MIRT1099075	hsa-miR-3122	CLIP-seq
MIRT1099076	hsa-miR-3165	CLIP-seq
MIRT1099093	hsa-miR-3200-5p	CLIP-seq
MIRT1099094	hsa-miR-3664-5p	CLIP-seq
MIRT1099079	hsa-miR-3689a-3p	CLIP-seq
MIRT1099080	hsa-miR-3689c	CLIP-seq
MIRT1099095	hsa-miR-371-5p	CLIP-seq
MIRT1099096	hsa-miR-371b-5p	CLIP-seq
MIRT1099081	hsa-miR-3913-5p	CLIP-seq
MIRT1099083	hsa-miR-4483	CLIP-seq
MIRT1099099	hsa-miR-4522	CLIP-seq
MIRT1099100	hsa-miR-4649-3p	CLIP-seq
MIRT1099086	hsa-miR-4728-5p	CLIP-seq
MIRT1099087	hsa-miR-4761-5p	CLIP-seq

Show/Hide all (20)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001533	Component	Cornified envelope	IEA
GO:0002803	Process	Positive regulation of antibacterial peptide production	IMP	17012259
GO:0004222	Function	Metalloendopeptidase activity	TAS
GO:0004252	Function	Serine-type endopeptidase activity	IBA
GO:0004252	Function	Serine-type endopeptidase activity	IEA
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IMP	17012259
GO:0006508	Process	Proteolysis	IEA
GO:0008233	Function	Peptidase activity	IEA
GO:0008233	Function	Peptidase activity	IMP	17012259
GO:0008236	Function	Serine-type peptidase activity	IEA
GO:0008236	Function	Serine-type peptidase activity	TAS	8034709
GO:0008544	Process	Epidermis development	TAS	8034709
GO:0016787	Function	Hydrolase activity	IEA
GO:0022617	Process	Extracellular matrix disassembly	TAS
GO:0030141	Component	Secretory granule	IBA
GO:0051604	Process	Protein maturation	IBA
GO:0097209	Component	Epidermal lamellar body	IDA	15675955

MIM	HGNC	e!Ensembl
604438	6368	ENSG00000169035

P49862

Protein name

Kallikrein-7 (hK7) (EC 3.4.21.117) (Serine protease 6) (Stratum corneum chymotryptic enzyme) (hSCCE)

Protein function

May catalyze the degradation of intercellular cohesive structures in the cornified layer of the skin in the continuous shedding of cells from the skin surface. Specific for amino acid residues with aromatic side chains in the P1 position. Cleave

PDB

2QXG , 2QXH , 2QXI , 2QXJ , 3BSQ , 5FAH , 5Y9L , 5YJK , 6SHH , 6SHI , 6SJU , 6Y4S

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00089	Trypsin	30 → 245	Trypsin	Domain

Tissue specificity

TISSUE SPECIFICITY: Abundantly expressed in the skin and is expressed by keratinocytes in the epidermis. Also expressed in the brain, mammary gland, cerebellum, spinal cord and kidney. Lower levels in salivary glands, uterus, thymus, thyroid, placenta, tr

Sequence

MARSLLLPLQILLLSLALETAGEEAQGDKIIDGAPCARGSHPWQVALLSGNQLHCGGVLV
NERWVLTAAHCKMNEYTVHLGSDTLGDRRAQRIKASKSFRHPGYSTQTHVNDLMLVKLNS
QARLSSMVKKVRLPSRCEPPGTTCTVSGWGTTTSPDVTFPSDLMCVDVKLISPQDCTKVY
KDLLENSMLCAGIPDSKKNACNGDSGGPLVCRGTLQGLVSWGTFPCGQPNDPGVYTQVCK
FTKWINDTMKKHR

Sequence length

253

Interactions

View interactions

	Reactome
			Degradation of the extracellular matrix

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ERYTHEMATOSQUAMOUS DERMATOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEBORRHEIC DERMATITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

KLK7 (kallikrein related peptidase 7)