Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	56475
Gene name	Reprimo, TP53 dependent G2 arrest mediator homolog
Gene symbol	RPRM
Synonyms (NCBI Gene)	REPRIMO
Chromosome	2
Chromosome location	2q23.3

Show/Hide all (71)

miRTarBase ID	miRNA	Experiments	Reference
MIRT551305	hsa-miR-548m	PAR-CLIP	21572407
MIRT551304	hsa-miR-4678	PAR-CLIP	21572407
MIRT551303	hsa-miR-6887-3p	PAR-CLIP	21572407
MIRT551302	hsa-miR-4749-3p	PAR-CLIP	21572407
MIRT458459	hsa-miR-5197-3p	PAR-CLIP	23592263
MIRT458458	hsa-miR-6165	PAR-CLIP	23592263
MIRT458457	hsa-miR-4768-3p	PAR-CLIP	23592263
MIRT458456	hsa-miR-1253	PAR-CLIP	23592263
MIRT458455	hsa-miR-4481	PAR-CLIP	23592263
MIRT458454	hsa-miR-4745-5p	PAR-CLIP	23592263
MIRT458453	hsa-miR-4722-5p	PAR-CLIP	23592263
MIRT458451	hsa-miR-4434	PAR-CLIP	23592263
MIRT458452	hsa-miR-4516	PAR-CLIP	23592263
MIRT458450	hsa-miR-5703	PAR-CLIP	23592263
MIRT458449	hsa-miR-6081	PAR-CLIP	23592263
MIRT458448	hsa-miR-6827-5p	PAR-CLIP	23592263
MIRT458447	hsa-miR-6090	PAR-CLIP	23592263
MIRT458446	hsa-miR-4300	PAR-CLIP	23592263
MIRT458445	hsa-miR-5591-5p	PAR-CLIP	23592263
MIRT458444	hsa-miR-6726-5p	PAR-CLIP	23592263
MIRT458443	hsa-miR-920	PAR-CLIP	23592263
MIRT458442	hsa-miR-1343-5p	PAR-CLIP	23592263
MIRT458441	hsa-miR-939-5p	PAR-CLIP	23592263
MIRT458440	hsa-miR-4723-5p	PAR-CLIP	23592263
MIRT458439	hsa-miR-5698	PAR-CLIP	23592263
MIRT458438	hsa-miR-6870-5p	PAR-CLIP	23592263
MIRT458436	hsa-miR-7111-5p	PAR-CLIP	23592263
MIRT458437	hsa-miR-6795-5p	PAR-CLIP	23592263
MIRT458435	hsa-miR-6887-5p	PAR-CLIP	23592263
MIRT458434	hsa-miR-1233-5p	PAR-CLIP	23592263
MIRT458433	hsa-miR-6778-5p	PAR-CLIP	23592263
MIRT458432	hsa-miR-6788-5p	PAR-CLIP	23592263
MIRT551305	hsa-miR-548m	PAR-CLIP	21572407
MIRT551304	hsa-miR-4678	PAR-CLIP	21572407
MIRT551303	hsa-miR-6887-3p	PAR-CLIP	21572407
MIRT551302	hsa-miR-4749-3p	PAR-CLIP	21572407
MIRT458459	hsa-miR-5197-3p	PAR-CLIP	23592263
MIRT458458	hsa-miR-6165	PAR-CLIP	23592263
MIRT458457	hsa-miR-4768-3p	PAR-CLIP	23592263
MIRT458456	hsa-miR-1253	PAR-CLIP	23592263
MIRT458455	hsa-miR-4481	PAR-CLIP	23592263
MIRT458454	hsa-miR-4745-5p	PAR-CLIP	23592263
MIRT458453	hsa-miR-4722-5p	PAR-CLIP	23592263
MIRT458451	hsa-miR-4434	PAR-CLIP	23592263
MIRT458452	hsa-miR-4516	PAR-CLIP	23592263
MIRT458450	hsa-miR-5703	PAR-CLIP	23592263
MIRT458449	hsa-miR-6081	PAR-CLIP	23592263
MIRT458448	hsa-miR-6827-5p	PAR-CLIP	23592263
MIRT458447	hsa-miR-6090	PAR-CLIP	23592263
MIRT458446	hsa-miR-4300	PAR-CLIP	23592263
MIRT458445	hsa-miR-5591-5p	PAR-CLIP	23592263
MIRT458444	hsa-miR-6726-5p	PAR-CLIP	23592263
MIRT458443	hsa-miR-920	PAR-CLIP	23592263
MIRT458442	hsa-miR-1343-5p	PAR-CLIP	23592263
MIRT458441	hsa-miR-939-5p	PAR-CLIP	23592263
MIRT458440	hsa-miR-4723-5p	PAR-CLIP	23592263
MIRT458439	hsa-miR-5698	PAR-CLIP	23592263
MIRT458438	hsa-miR-6870-5p	PAR-CLIP	23592263
MIRT458436	hsa-miR-7111-5p	PAR-CLIP	23592263
MIRT458437	hsa-miR-6795-5p	PAR-CLIP	23592263
MIRT458435	hsa-miR-6887-5p	PAR-CLIP	23592263
MIRT458434	hsa-miR-1233-5p	PAR-CLIP	23592263
MIRT458433	hsa-miR-6778-5p	PAR-CLIP	23592263
MIRT458432	hsa-miR-6788-5p	PAR-CLIP	23592263
MIRT1317613	hsa-miR-2113	CLIP-seq
MIRT1317614	hsa-miR-335	CLIP-seq
MIRT1317615	hsa-miR-597	CLIP-seq
MIRT2318907	hsa-miR-1236	CLIP-seq
MIRT2318908	hsa-miR-3119	CLIP-seq
MIRT2318909	hsa-miR-4639-3p	CLIP-seq
MIRT2318910	hsa-miR-668	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
FOXA1	Repression	19917725

Show/Hide all (9)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	25416956, 32296183
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	TAS	10930422
GO:0007346	Process	Regulation of mitotic cell cycle	IBA
GO:0007346	Process	Regulation of mitotic cell cycle	IEA
GO:0016020	Component	Membrane	IEA
GO:0051726	Process	Regulation of cell cycle	IEA
GO:0051726	Process	Regulation of cell cycle	TAS	10930422

MIM	HGNC	e!Ensembl
612171	24201	ENSG00000177519

Q9NS64

Protein name

Protein reprimo

Protein function

May be involved in the regulation of p53-dependent G2 arrest of the cell cycle. Seems to induce cell cycle arrest by inhibiting CDK1 activity and nuclear translocation of the CDC2 cyclin B1 complex (By similarity).

Family and domains

Sequence

MNPALGNQTDVAGLFLANSSEALERAVRCCTQASVVTDDGFAEGGPDERSLYIMRVVQIA
VMCVLSLTVVFGIFFLGCNLLIKSEGMINFLVKDRRPSKEVEAVVVGPY

Sequence length

109

Interactions

View interactions

	KEGG
	p53 signaling pathway

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BARRETT ESOPHAGUS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MALUNION FRACTURE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (20)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	25629980		★★★★★ ★☆☆☆☆ Found in Text Mining only
Barrett Epithelium	Barrett Epithelium	CTD_human_DG	17121882		★★★★★ ★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	CTD_human_DG	17121882		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	26796959, 28809778	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	16752411	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	31221478		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	16752411	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	20154727	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	CTD_human_DG	17121882		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	25629980		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	CTD_human_DG	17121882		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	15700311, 31221478		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	25954972, 27992600, 29312555		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	17611651, 21810943, 23982217, 25954972, 28562620, 29312555		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	25814384		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	16752411	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	25954972, 27992600, 29312555		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	18829507		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	20178103, 25954972, 26823831, 27528034, 27992600, 35549646, 40244164	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	16752411	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

RPRM (reprimo, TP53 dependent G2 arrest mediator homolog)