LTB4R2 (leukotriene B4 receptor 2)

Gene

• Entrez ID: 56413
• Gene name: Leukotriene B4 receptor 2
• Gene symbol: LTB4R2
• Synonyms (NCBI Gene): BLT2, BLTR2, JULF2, KPG_004, LTB4-R 2, LTB4-R2, NOP9
• Chromosome: 14
• Chromosome location: 14q12

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT721493	hsa-miR-3126-3p	HITS-CLIP	19536157
MIRT721492	hsa-miR-6729-3p	HITS-CLIP	19536157
MIRT721491	hsa-miR-6887-3p	HITS-CLIP	19536157
MIRT721490	hsa-miR-1470	HITS-CLIP	19536157
MIRT721489	hsa-miR-4667-3p	HITS-CLIP	19536157
MIRT721488	hsa-miR-6072	HITS-CLIP	19536157
MIRT721487	hsa-miR-6891-3p	HITS-CLIP	19536157
MIRT721486	hsa-miR-6870-3p	HITS-CLIP	19536157
MIRT721485	hsa-miR-4469	HITS-CLIP	19536157
MIRT721484	hsa-miR-4749-3p	HITS-CLIP	19536157
MIRT721483	hsa-miR-874-5p	HITS-CLIP	19536157
MIRT498262	hsa-miR-6507-3p	PAR-CLIP	22291592
MIRT498261	hsa-miR-8080	PAR-CLIP	22291592
MIRT498260	hsa-miR-1264	PAR-CLIP	22291592
MIRT721493	hsa-miR-3126-3p	HITS-CLIP	19536157
MIRT721492	hsa-miR-6729-3p	HITS-CLIP	19536157
MIRT721491	hsa-miR-6887-3p	HITS-CLIP	19536157
MIRT721490	hsa-miR-1470	HITS-CLIP	19536157
MIRT721489	hsa-miR-4667-3p	HITS-CLIP	19536157
MIRT721488	hsa-miR-6072	HITS-CLIP	19536157
MIRT721487	hsa-miR-6891-3p	HITS-CLIP	19536157
MIRT721486	hsa-miR-6870-3p	HITS-CLIP	19536157
MIRT721485	hsa-miR-4469	HITS-CLIP	19536157
MIRT721484	hsa-miR-4749-3p	HITS-CLIP	19536157
MIRT721483	hsa-miR-874-5p	HITS-CLIP	19536157
MIRT498262	hsa-miR-6507-3p	PAR-CLIP	22291592
MIRT498261	hsa-miR-8080	PAR-CLIP	22291592
MIRT498260	hsa-miR-1264	PAR-CLIP	22291592
MIRT1122089	hsa-miR-1912	CLIP-seq
MIRT1122090	hsa-miR-3130-5p	CLIP-seq
MIRT1122091	hsa-miR-3154	CLIP-seq
MIRT1122092	hsa-miR-4482	CLIP-seq
MIRT1122093	hsa-miR-500a	CLIP-seq
MIRT1122094	hsa-miR-554	CLIP-seq
MIRT1122095	hsa-miR-618	CLIP-seq
MIRT1122089	hsa-miR-1912	CLIP-seq
MIRT1122090	hsa-miR-3130-5p	CLIP-seq
MIRT1122092	hsa-miR-4482	CLIP-seq
MIRT1122093	hsa-miR-500a	CLIP-seq
MIRT2264959	hsa-miR-135a	CLIP-seq
MIRT2264960	hsa-miR-135b	CLIP-seq
MIRT2264961	hsa-miR-199a-5p	CLIP-seq
MIRT2264962	hsa-miR-199b-5p	CLIP-seq
MIRT2264963	hsa-miR-513b	CLIP-seq
MIRT1122089	hsa-miR-1912	CLIP-seq
MIRT1122090	hsa-miR-3130-5p	CLIP-seq
MIRT1122092	hsa-miR-4482	CLIP-seq
MIRT1122093	hsa-miR-500a	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001632	Function	Leukotriene B4 receptor activity	IBA
GO:0001632	Function	Leukotriene B4 receptor activity	IEA
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004974	Function	Leukotriene receptor activity	IEA
GO:0004974	Function	Leukotriene receptor activity	TAS	10889186
GO:0005654	Component	Nucleoplasm	IDA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	10913346
GO:0006935	Process	Chemotaxis	TAS	10889186
GO:0007165	Process	Signal transduction	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007194	Process	Negative regulation of adenylate cyclase activity	TAS	10889186
GO:0007218	Process	Neuropeptide signaling pathway	IBA
GO:0008528	Function	G protein-coupled peptide receptor activity	IBA
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IEA
GO:0051546	Process	Keratinocyte migration	IEA
GO:0061737	Process	Leukotriene signaling pathway	IEA

Other IDs

• MIM: 605773
• HGNC: 19260
• e!Ensembl: ENSG00000213906

Protein

• UniProt ID: Q9NPC1
• Protein name: Leukotriene B4 receptor 2 (LTB4-R 2) (LTB4-R2) (LTB4 receptor JULF2) (Leukotriene B4 receptor BLT2) (Seven transmembrane receptor BLTR2)
• Protein function: Low-affinity receptor for leukotrienes including leukotriene B4. Mediates chemotaxis of granulocytes and macrophages. The response is mediated via G-proteins that activate a phosphatidylinositol-calcium second messenger system. The rank order of
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00001	7tm_1	37 → 288	7 transmembrane receptor (rhodopsin family)	Family

• Tissue specificity: TISSUE SPECIFICITY: Widely expressed.
• Sequence:

  MSVCYRPPGNETLLSWKTSRATGTAFLLLAALLGLPGNGFVVWSLAGWRPARGRPLAATL
  VLHLALADGAVLLLTPLFVAFLTRQAWPLGQAGCKAVYYVCALSMYASVLLTGLLSLQRC
  LAVTRPFLAPRLRSPALARRLLLAVWLAALLLAVPAAVYRHLWRDRVCQLCHPSPVHAAA
  HLSLETLTAFVLPFGLMLGCYSVTLARLRGARWGSGRHGARVGRLVSAIVLAFGLLWAPY
  HAVNLLQAVAALAPPEGALAKLGGAGQAARAGTTALAFFSSSVNPVLYVFTAGDLLPRAG
  PRFLTRLFEGSGEARGGGRSREGTMELRTTPQLKVVGQGRGNGDPGGGMEKDGPEWDL

• Sequence length: 358

Pathways

KEGG:

Calcium signaling pathway
Neuroactive ligand-receptor interaction

Reactome:

Leukotriene receptors
G alpha (q) signalling events

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ANORECTAL MALFORMATION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	18781173		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	14656734		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	Pubtator	16624877	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	12913925, 20656922		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	19448154, 21596548, 23167751, 23603839, 29042028, 29170475		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	22206291	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	14656734		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	26696753	Associate	★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	20600831, 21252614		★☆☆☆☆ Found in Text Mining only
Blast Phase	Blast phase chronic myelogenous leukemia	BEFREE	26966074		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	23145117, 30015917		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	23145117, 26299331	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	20600831, 21252614		★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	26696753, 37455213	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	26597704		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	LHGDN	18323512		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	25480980		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	30553812		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	12913925		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	29790996		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	15996849		★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	BEFREE	23603839		★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	27475906	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	26966074		★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	23145117	Inhibit	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	23145117, 30015917		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	26597704		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	18781173		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	22426480, 23986446		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	20600831, 21252614		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	29170475		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	29790996		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	26966074		★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	16689996		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	18781173, 23799854, 26597704, 30553812		★☆☆☆☆ Found in Text Mining only
Neutrophilia (disorder)	Neutrophilia	BEFREE	23347335		★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	25677035	Associate	★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	18421027		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	26597704		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	18781173		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	18781173, 23017243	Associate	★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	22426480, 23986446		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	23986446	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	22206291	Associate	★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	12913925		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	LHGDN	12913925		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	29898809		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	38139172	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	21252614	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	18781173	Associate	★☆☆☆☆ Found in Text Mining only