METTL3 (methyltransferase 3, N6-adenosine-methyltransferase complex catalytic subunit)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID 56339
Gene name Methyltransferase 3, N6-adenosine-methyltransferase complex catalytic subunit
Gene symbol METTL3
Synonyms (NCBI Gene)
IME4M6AMT-A70Spo8hMETTL3
Chromosome 14
Chromosome location 14q11.2
Summary This gene encodes the 70 kDa subunit of MT-A which is part of N6-adenosine-methyltransferase. This enzyme is involved in the posttranscriptional methylation of internal adenosine residues in eukaryotic mRNAs, forming N6-methyladenosine. [provided by RefSe
miRNA miRNA information provided by mirtarbase database.
11
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (11)
miRTarBase ID miRNA Experiments Reference
MIRT732316 hsa-miR-33a-3p Luciferase reporter assayqRT-PCRWestern blot 27856248
MIRT732316 hsa-miR-33a-3p Luciferase reporter assayqRT-PCRWestern blot 27856248
MIRT733010 hsa-miR-93-3p Luciferase reporter assay 33660100
MIRT735014 hsa-miR-126-5p Luciferase reporter assayWestern blottingImmunoprecipitaion (IP)Immunohistochemistry (IHC)ImmunofluorescenceqRT-PCR 33098220
MIRT735128 hsa-miR-20b-3p Luciferase reporter assayWestern blottingImmunofluorescenceqRT-PCR 32826852
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
69
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (69)
GO ID Ontology Definition Evidence Reference
GO:0000398 Process MRNA splicing, via spliceosome IMP 25719671, 26321680
GO:0000398 Process MRNA splicing, via spliceosome ISS
GO:0001510 Process RNA methylation IEA
GO:0001510 Process RNA methylation IMP 9409616
GO:0001734 Function MRNA m(6)A methyltransferase activity IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
612472 17563 ENSG00000165819
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q86U44
Protein name N(6)-adenosine-methyltransferase catalytic subunit METTL3 (EC 2.1.1.348) (Methyltransferase-like protein 3) (hMETTL3) (N(6)-adenosine-methyltransferase 70 kDa subunit) (MT-A70)
Protein function The METTL3-METTL14 heterodimer forms a N6-methyltransferase complex that methylates adenosine residues at the N(6) position of some RNAs and regulates various processes such as the circadian clock, differentiation of embryonic and hematopoietic
PDB 5IL0 , 5IL1 , 5IL2 , 5K7M , 5K7U , 5K7W , 5L6D , 5L6E , 5TEY , 5YZ9 , 6TTP , 6TTT , 6TTV , 6TTW , 6TTX , 6TU1 , 6Y4G , 7ACD , 7NHG , 7NHH , 7NHI , 7NHJ , 7NHV , 7NI7 , 7NI8 , 7NI9 , 7NIA , 7NID , 7O08 , 7O09 , 7O0L , 7O0M , 7O0P , 7O0Q , 7O0R , 7O27 , 7O28 , 7O29 , 7O2E , 7O2F , 7O2H , 7O2I , 7O2X , 7OED , 7OEE , 7OEF , 7OEG , 7OEH , 7OEI , 7OEJ , 7OEK
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF05063 MT-A70 389 → 550 MT-A70 Family
Tissue specificity TISSUE SPECIFICITY: Widely expressed at low level. Expressed in spleen, thymus, prostate, testis, ovary, small intestine, colon and peripheral blood leukocytes. {ECO:0000269|PubMed:9409616}.
Sequence 
MSDTWSSIQAHKKQLDSLRERLQRRRKQDSGHLDLRNPEAALSPTFRSDSPVPTAPTSGG
PKPSTASAVPELATDPELEKKLLHHLSDLALTLPTDAVSICLAISTPDAPATQDGVESLL
QKFAAQELIEVKRGLLQDDAHPTLVTYADHSKLSAMMGAVAEKKGPGEVAGTVTGQKRRA
EQDSTTVAAFASSLVSGLNSSASEPAKEPAKKSRKHAASDVDLEIESLLNQQSTKEQQSK
KVSQEILELLNTTTAKEQSIVEKFRSRGRAQVQEFCDYGTKEECMKASDADRPCRKLHFR
RIINKHTDESLGDCSFLNTCFHMDTCKYVHYEIDACMDSEAPGSKDHTPSQELALTQSVG
GDSSADRLFPPQWICCDIRYLDVSILGKFAVVMADPPWDIHMELPYGTLTDDEMRRLNIP
VLQDDGFLFLWVTGRAMELGRECLNLWGYERVDEIIWVKTNQLQRIIRTGRTGHWLNHGK
EHCLVGVKGNPQGFNQGLDCDVIVAEVRSTSHKPDEIYGMIERLSPGTRKIELFGRPHNV
QPNWITLGNQLDGIHLLDPDVVARFKQRYPDGIISKPKNL
Sequence length 580
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  Reactome
    Processing of Capped Intron-Containing Pre-mRNA
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
4
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Show/Hide Unknown Diseases (4)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
EMPHYSEMA — CTD
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
FATTY LIVER — CTD
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS — CTD
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
MULTIPLE MYELOMA — CTD
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Show/Hide Text Mining Associations (166)
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Acute lymphocytic leukemia Lymphocytic Leukemia BEFREE 31429529
★★★★★
★☆☆☆☆
Found in Text Mining only
Adenocarcinoma of lung (disorder) Lung adenocarcinoma BEFREE 27117702
★★★★★
★☆☆☆☆
Found in Text Mining only
Adrenocortical Carcinoma Adrenocortical carcinoma Pubtator 33725886 Inhibit
★★★★★
★☆☆☆☆
Found in Text Mining only
Adult Acute Lymphocytic Leukemia Lymphocytic Leukemia BEFREE 31429529
★★★★★
★☆☆☆☆
Found in Text Mining only
Alzheimer Disease Alzheimer disease Pubtator 32847866, 34593014 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only
Alzheimer Disease Alzheimer disease Pubtator 37373264 Stimulate
★★★★★
★☆☆☆☆
Found in Text Mining only
Anaplasia Anaplasia BEFREE 28991227
★★★★★
★☆☆☆☆
Found in Text Mining only
Aortic valve calcification Aortic valve calcification BEFREE 31761339
★★★★★
★☆☆☆☆
Found in Text Mining only
Aortic Valve Stenosis Aortic Valve Sclerosis BEFREE 31761339
★★★★★
★☆☆☆☆
Found in Text Mining only
Arthritis Rheumatoid Rheumatoid arthritis Pubtator 31772500 Stimulate
★★★★★
★☆☆☆☆
Found in Text Mining only