IL36G (interleukin 36 gamma)

Gene

• Entrez ID: 56300
• Gene name: Interleukin 36 gamma
• Gene symbol: IL36G
• Synonyms (NCBI Gene): IL-1F9, IL-1H1, IL-1RP2, IL1E, IL1F9, IL1H1, IL1RP2
• Chromosome: 2
• Chromosome location: 2q14.1
• Summary: The protein encoded by this gene is a member of the interleukin 1 cytokine family. The activity of this cytokine is mediated by interleukin 1 receptor-like 2 (IL1RL2/IL1R-rp2), and is specifically inhibited by interleukin 1 family, member 5 (IL1F5/IL-1 de

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT2015442	hsa-miR-4778-3p	CLIP-seq
MIRT2247748	hsa-miR-3074-3p	CLIP-seq
MIRT2247749	hsa-miR-410	CLIP-seq
MIRT2247750	hsa-miR-4328	CLIP-seq
MIRT2247751	hsa-miR-4795-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002376	Process	Immune system process	IEA
GO:0005125	Function	Cytokine activity	IBA
GO:0005125	Function	Cytokine activity	IEA
GO:0005149	Function	Interleukin-1 receptor binding	IEA
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005886	Component	Plasma membrane	IDA
GO:0006954	Process	Inflammatory response	IBA
GO:0006954	Process	Inflammatory response	IEA
GO:0006955	Process	Immune response	IBA
GO:0006955	Process	Immune response	IEA
GO:0007267	Process	Cell-cell signaling	TAS	10744718
GO:0019221	Process	Cytokine-mediated signaling pathway	IBA
GO:0045087	Process	Innate immune response	IEA
GO:0071222	Process	Cellular response to lipopolysaccharide	IBA

Other IDs

• MIM: 605542
• HGNC: 15741
• e!Ensembl: ENSG00000136688

Protein

• UniProt ID: Q9NZH8
• Protein name: Interleukin-36 gamma (IL-1-related protein 2) (IL-1RP2) (Interleukin-1 epsilon) (IL-1 epsilon) (Interleukin-1 family member 9) (IL-1F9) (Interleukin-1 homolog 1) (IL-1H1)
• Protein function: Cytokine that binds to and signals through the IL1RL2/IL-36R receptor which in turn activates NF-kappa-B and MAPK signaling pathways in target cells. Part of the IL-36 signaling system that is thought to be present in epithelial barriers and to
• PDB: 4IZE, 4P0J, 4P0K, 4P0L, 6P9E
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00340	IL1	53 → 165	Interleukin-1 / 18	Domain

• Tissue specificity: TISSUE SPECIFICITY: Highly expressed in tissues containing epithelial cells: skin, lung, stomach and esophagus. Expressed in bronchial epithelial. In skin is expressed only in keratinocytes but not in fibroblasts, endothelial cells or melanocytes. Up-regu
• Sequence:

  MRGTPGDADGGGRAVYQSMCKPITGTINDLNQQVWTLQGQNLVAVPRSDSVTPVTVAVIT
  CKYPEALEQGRGDPIYLGIQNPEMCLYCEKVGEQPTLQLKEQKIMDLYGQPEPVKPFLFY
  RAKTGRTSTLESVAFPDWFIASSKRDQPIILTSELGKSYNTAFELNIND

• Sequence length: 169

Pathways

KEGG:

Cytokine-cytokine receptor interaction

Reactome:

Interleukin-36 pathway

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ATOPIC ECZEMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Asthma	Asthma	Pubtator	19710636	Associate	★☆☆☆☆ Found in Text Mining only
Congenital ichthyosis	Congenital Ichthyosis	BEFREE	27554821		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	32220223	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	31596431, 40159643	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	29314201		★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	29314201		★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	Pubtator	31596431	Associate	★☆☆☆☆ Found in Text Mining only
Ichthyoses	Ichthyosis	BEFREE	27554821		★☆☆☆☆ Found in Text Mining only
Ichthyosis	Ichthyosis	Pubtator	27554821, 29803800	Associate	★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	36040155	Stimulate	★☆☆☆☆ Found in Text Mining only
Pruritus	Pruritus	Pubtator	31596431	Associate	★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	25305315, 27554821, 30634937		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	30634937	Stimulate	★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	30634937, 31612239, 40159643	Associate	★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	BEFREE	28176791		★☆☆☆☆ Found in Text Mining only