Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
Entrez ID	5629
Gene name	Prospero homeobox 1
Gene symbol	PROX1
Synonyms (NCBI Gene)	-
Chromosome	1
Chromosome location	1q32.3
Summary	The protein encoded by this gene is a member of the homeobox transcription factor family. Members of this family contain a homeobox domain that consists of a 60-amino acid helix-turn-helix structure that binds DNA and RNA. The protein encoded by this gene

Show/Hide all (75)

miRTarBase ID	miRNA	Experiments	Reference
MIRT003630	hsa-miR-181a-5p	Luciferase reporter assayqRT-PCRWestern blot	20558617
MIRT003630	hsa-miR-181a-5p	Luciferase reporter assayqRT-PCRWestern blot	20558617
MIRT018128	hsa-miR-335-5p	Microarray	18185580
MIRT019318	hsa-miR-148b-3p	Microarray	17612493
MIRT037355	hsa-miR-877-5p	CLASH	23622248
MIRT510934	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT510932	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT510931	hsa-miR-3924	HITS-CLIP	21572407
MIRT707916	hsa-miR-377-3p	HITS-CLIP	21572407
MIRT566288	hsa-miR-2681-5p	HITS-CLIP	21572407
MIRT510930	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT510930	hsa-miR-1277-5p	PAR-CLIP	20371350
MIRT510934	hsa-miR-5011-5p	PAR-CLIP	20371350
MIRT555208	hsa-miR-4666a-5p	PAR-CLIP	20371350
MIRT510932	hsa-miR-190a-3p	PAR-CLIP	20371350
MIRT510931	hsa-miR-3924	PAR-CLIP	20371350
MIRT566288	hsa-miR-2681-5p	PAR-CLIP	20371350
MIRT510930	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT510934	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT555212	hsa-miR-4501	PAR-CLIP	21572407
MIRT555211	hsa-miR-567	PAR-CLIP	21572407
MIRT555210	hsa-miR-223-5p	PAR-CLIP	21572407
MIRT555209	hsa-miR-6867-5p	PAR-CLIP	21572407
MIRT555208	hsa-miR-4666a-5p	PAR-CLIP	21572407
MIRT510932	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT510931	hsa-miR-3924	PAR-CLIP	21572407
MIRT555207	hsa-miR-297	PAR-CLIP	21572407
MIRT555206	hsa-miR-8070	PAR-CLIP	21572407
MIRT510934	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT510932	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT510931	hsa-miR-3924	PAR-CLIP	23446348
MIRT510930	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT003630	hsa-miR-181a-5p	Luciferase reporter assayqRT-PCRWestern blot	25706394
MIRT003630	hsa-miR-181a-5p	Luciferase reporter assayqRT-PCRWestern blot	25706394
MIRT555210	hsa-miR-223-5p	HITS-CLIP	27418678
MIRT555210	hsa-miR-223-5p	HITS-CLIP	27418678
MIRT555209	hsa-miR-6867-5p	HITS-CLIP	27418678
MIRT555209	hsa-miR-6867-5p	HITS-CLIP	27418678
MIRT733604	hsa-miR-140-5p	ImmunofluorescenceqRT-PCRWestern blotting	33987369
MIRT510934	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT510932	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT510931	hsa-miR-3924	HITS-CLIP	21572407
MIRT707916	hsa-miR-377-3p	HITS-CLIP	21572407
MIRT566288	hsa-miR-2681-5p	HITS-CLIP	21572407
MIRT510930	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT510930	hsa-miR-1277-5p	PAR-CLIP	20371350
MIRT510934	hsa-miR-5011-5p	PAR-CLIP	20371350
MIRT555208	hsa-miR-4666a-5p	PAR-CLIP	20371350
MIRT510932	hsa-miR-190a-3p	PAR-CLIP	20371350
MIRT510931	hsa-miR-3924	PAR-CLIP	20371350
MIRT566288	hsa-miR-2681-5p	PAR-CLIP	20371350
MIRT510930	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT510934	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT555212	hsa-miR-4501	PAR-CLIP	21572407
MIRT555211	hsa-miR-567	PAR-CLIP	21572407
MIRT555210	hsa-miR-223-5p	PAR-CLIP	21572407
MIRT555209	hsa-miR-6867-5p	PAR-CLIP	21572407
MIRT555208	hsa-miR-4666a-5p	PAR-CLIP	21572407
MIRT510932	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT510931	hsa-miR-3924	PAR-CLIP	21572407
MIRT555207	hsa-miR-297	PAR-CLIP	21572407
MIRT555206	hsa-miR-8070	PAR-CLIP	21572407
MIRT510934	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT510932	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT510931	hsa-miR-3924	PAR-CLIP	23446348
MIRT510930	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT756420	hsa-miR-340-5p	Luciferase reporter assayWestern blottingqRT-PCR	34495369
MIRT1265313	hsa-miR-203	CLIP-seq
MIRT1265314	hsa-miR-3150b-3p	CLIP-seq
MIRT1265315	hsa-miR-3613-3p	CLIP-seq
MIRT1265316	hsa-miR-3662	CLIP-seq
MIRT1265317	hsa-miR-4689	CLIP-seq
MIRT1265318	hsa-miR-4712-3p	CLIP-seq
MIRT1265319	hsa-miR-4784	CLIP-seq
MIRT1265320	hsa-miR-653	CLIP-seq

Show/Hide all (4)

Transcription factor	Regulation	Reference
HEY1	Repression	22719258
NFKB1	Activation	19901262
PAX6	Activation	11554737
RELA	Activation	19901262

127

Show/Hide all (127)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	15205472
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000785	Component	Chromatin	ISA
GO:0000976	Function	Transcription cis-regulatory region binding	IDA	19210544
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	ISS
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISS
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IDA	15143342, 15205472, 16488887, 19264593
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	19210544
GO:0001822	Process	Kidney development	IEP	8812486
GO:0001889	Process	Liver development	IEA
GO:0001889	Process	Liver development	IEP	11789987
GO:0001938	Process	Positive regulation of endothelial cell proliferation	IDA	19210544
GO:0001945	Process	Lymph vessel development	IEA
GO:0001946	Process	Lymphangiogenesis	IDA	12412020
GO:0002088	Process	Lens development in camera-type eye	IEP	8812486
GO:0002089	Process	Lens morphogenesis in camera-type eye	IEA
GO:0002194	Process	Hepatocyte cell migration	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003677	Function	DNA binding	IMP	18815287
GO:0005515	Function	Protein binding	IPI	15205472, 16488887, 18815287, 19210544, 19264593, 21988832
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	11850194, 15143342, 15205472, 19210544
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IDA	11850194
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006366	Process	Transcription by RNA polymerase II	IEA
GO:0007405	Process	Neuroblast proliferation	IEA
GO:0007406	Process	Negative regulation of neuroblast proliferation	IEA
GO:0007417	Process	Central nervous system development	IEA
GO:0007420	Process	Brain development	IEP	8812486
GO:0007623	Process	Circadian rhythm	IEA
GO:0008283	Process	Cell population proliferation	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IDA	12198161
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	IMP	17062673
GO:0010468	Process	Regulation of gene expression	IDA	12198161
GO:0010468	Process	Regulation of gene expression	IEA
GO:0010595	Process	Positive regulation of endothelial cell migration	IDA	19210544
GO:0010631	Process	Epithelial cell migration	IEA
GO:0016922	Function	Nuclear receptor binding	IPI	15143342, 15205472, 16488887
GO:0021516	Process	Dorsal spinal cord development	ISS	11789987
GO:0021542	Process	Dentate gyrus development	IEA
GO:0021542	Process	Dentate gyrus development	ISS
GO:0021707	Process	Cerebellar granule cell differentiation	IEA
GO:0021707	Process	Cerebellar granule cell differentiation	ISS
GO:0021915	Process	Neural tube development	ISS	11789987
GO:0030240	Process	Skeletal muscle thin filament assembly	IEA
GO:0030240	Process	Skeletal muscle thin filament assembly	ISS
GO:0030324	Process	Lung development	IEP	8812486
GO:0030910	Process	Olfactory placode formation	ISS	11789987
GO:0031016	Process	Pancreas development	IEA
GO:0031016	Process	Pancreas development	IEP	11789987
GO:0031667	Process	Response to nutrient levels	IEA
GO:0035295	Process	Tube development	IEA
GO:0042752	Process	Regulation of circadian rhythm	IMP	23723244
GO:0043049	Process	Otic placode formation	ISS	11789987
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0045071	Process	Negative regulation of viral genome replication	IDA	19264593
GO:0045165	Process	Cell fate commitment	IEA
GO:0045787	Process	Positive regulation of cell cycle	IEA
GO:0045787	Process	Positive regulation of cell cycle	ISS
GO:0045892	Process	Negative regulation of DNA-templated transcription	IDA	15143342, 15205472
GO:0045892	Process	Negative regulation of DNA-templated transcription	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IMP	16488887, 23723244
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	18815287
GO:0046619	Process	Lens placode formation involved in camera-type eye formation	IEA
GO:0046619	Process	Lens placode formation involved in camera-type eye formation	ISS	11850194
GO:0048511	Process	Rhythmic process	IEA
GO:0048646	Process	Anatomical structure formation involved in morphogenesis	IEA
GO:0048664	Process	Neuron fate determination	IEA
GO:0048839	Process	Inner ear development	IEA
GO:0048845	Process	Venous blood vessel morphogenesis	IEA
GO:0048845	Process	Venous blood vessel morphogenesis	ISS
GO:0050692	Function	DNA binding domain binding	IPI	15205472
GO:0050693	Function	LBD domain binding	IPI	15143342, 15205472
GO:0055005	Process	Ventricular cardiac myofibril assembly	IEA
GO:0055005	Process	Ventricular cardiac myofibril assembly	ISS
GO:0055009	Process	Atrial cardiac muscle tissue morphogenesis	IEA
GO:0055009	Process	Atrial cardiac muscle tissue morphogenesis	ISS
GO:0055010	Process	Ventricular cardiac muscle tissue morphogenesis	IEA
GO:0055010	Process	Ventricular cardiac muscle tissue morphogenesis	ISS
GO:0060042	Process	Retina morphogenesis in camera-type eye	ISS	11789987
GO:0060059	Process	Embryonic retina morphogenesis in camera-type eye	IEA
GO:0060059	Process	Embryonic retina morphogenesis in camera-type eye	IEP	12692551
GO:0060214	Process	Endocardium formation	IEA
GO:0060214	Process	Endocardium formation	ISS
GO:0060298	Process	Positive regulation of sarcomere organization	IEA
GO:0060298	Process	Positive regulation of sarcomere organization	ISS
GO:0060412	Process	Ventricular septum morphogenesis	IEA
GO:0060412	Process	Ventricular septum morphogenesis	ISS
GO:0060414	Process	Aorta smooth muscle tissue morphogenesis	IEA
GO:0060414	Process	Aorta smooth muscle tissue morphogenesis	ISS
GO:0060421	Process	Positive regulation of heart growth	IEA
GO:0060421	Process	Positive regulation of heart growth	ISS
GO:0060836	Process	Lymphatic endothelial cell differentiation	IDA	12198161
GO:0060836	Process	Lymphatic endothelial cell differentiation	IEA
GO:0060836	Process	Lymphatic endothelial cell differentiation	IEA
GO:0060837	Process	Blood vessel endothelial cell differentiation	IEA
GO:0060838	Process	Lymphatic endothelial cell fate commitment	IMP	18815287
GO:0061114	Process	Branching involved in pancreas morphogenesis	IEA
GO:0070309	Process	Lens fiber cell morphogenesis	IEA
GO:0070309	Process	Lens fiber cell morphogenesis	IEP	11850194
GO:0070365	Process	Hepatocyte differentiation	IEA
GO:0070365	Process	Hepatocyte differentiation	IEP	15232737
GO:0070858	Process	Negative regulation of bile acid biosynthetic process	IMP	16488887
GO:0072574	Process	Hepatocyte proliferation	IEA
GO:0090425	Process	Acinar cell differentiation	IEA
GO:0097150	Process	Neuronal stem cell population maintenance	IEA
GO:0097150	Process	Neuronal stem cell population maintenance	ISS
GO:1900748	Process	Positive regulation of vascular endothelial growth factor signaling pathway	IMP	19210544
GO:1901978	Process	Positive regulation of cell cycle checkpoint	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536
GO:2000179	Process	Positive regulation of neural precursor cell proliferation	IEA
GO:2000179	Process	Positive regulation of neural precursor cell proliferation	ISS
GO:2000979	Process	Positive regulation of forebrain neuron differentiation	IEA
GO:2000979	Process	Positive regulation of forebrain neuron differentiation	ISS

MIM	HGNC	e!Ensembl
601546	9459	ENSG00000117707

Q92786

Protein name

Prospero homeobox protein 1 (Homeobox prospero-like protein PROX1) (PROX-1)

Protein function

Transcription factor involved in developmental processes such as cell fate determination, gene transcriptional regulation and progenitor cell regulation in a number of organs. Plays a critical role in embryonic development and functions as a key

PDB

2LMD

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF05044	HPD	579 → 732	Homeo-prospero domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Most actively expressed in the developing lens. Detected also in embryonic brain, lung, liver and kidney. In adult, it is more abundant in heart and liver than in brain, skeletal muscle, kidney and pancreas. {ECO:0000269|PubMed:8812486

Sequence

MPDHDSTALLSRQTKRRRVDIGVKRTVGTASAFFAKARATFFSAMNPQGSEQDVEYSVVQ
HADGEKSNVLRKLLKRANSYEDAMMPFPGATIISQLLKNNMNKNGGTEPSFQASGLSSTG
SEVHQEDICSNSSRDSPPECLSPFGRPTMSQFDMDRLCDEHLRAKRARVENIIRGMSHSP
SVALRGNENEREMAPQSVSPRESYRENKRKQKLPQQQQQSFQQLVSARKEQKREERRQLK
QQLEDMQKQLRQLQEKFYQIYDSTDSENDEDGNLSEDSMRSEILDARAQDSVGRSDNEMC
ELDPGQFIDRARALIREQEMAENKPKREGNNKERDHGPNSLQPEGKHLAETLKQELNTAM
SQVVDTVVKVFSAKPSRQVPQVFPPLQIPQARFAVNGENHNFHTANQRLQCFGDVIIPNP
LDTFGNVQMASSTDQTEALPLVVRKNSSDQSASGPAAGGHHQPLHQSPLSATTGFTTSTF
RHPFPLPLMAYPFQSPLGAPSGSFSGKDRASPESLDLTRDTTSLRTKMSSHHLSHHPCSP
AHPPSTAEGLSLSLIKSECGDLQDMSEISPYSGSAMQEGLSPNHLKKAKLMFFYTRYPSS
NMLKTYFSDVKFNRCITSQLIKWFSNFREFYYIQMEKYARQAINDGVTSTEELSITRDCE
LYRALNMHYNKANDFEVPERFLEVAQITLREFFNAIIAGKDVDPSWKKAIYKVICKLDSE
VPEIFKSPNCLQELLHE

Sequence length

737

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (11)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CONGENITAL HEART DISEASE	—	ClinGen, Disgenet ClinGen, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, NON-INSULIN-DEPENDENT	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, TYPE 2	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC NEUROPATHY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC RETINOPATHY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FEMALE INFERTILITY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POLYCYSTIC OVARY SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROX1-related disorder	Likely benign; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (135)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenoid Cystic Carcinoma	Adenocarcinoma	BEFREE	29406257		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	18455124		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	26992918		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplastic astrocytoma	Anaplastic Astrocytoma	BEFREE	27626492		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	25176150		★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	27626492, 28035380		★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	27626492	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	25176150		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	27626492		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	27626492	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	17415710, 29059430, 31213129		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	29059430, 38206773	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	18455124, 25526434, 27411302, 31060342	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	17069925		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	18400094, 22023334	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	27411302, 36209277	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	24797520	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Small Cell	Small cell carcinoma	Pubtator	35400238	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	18400094		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	18400094, 22067331	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	11719431		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	12851706, 18455124, 23045246, 25242332		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Diseases	Colonic disease	Pubtator	18455124	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	22067331	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	18455124, 25242330, 25242332, 25684142, 26477307, 29162097, 30154153, 30396930, 31451731		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	18455124, 36594098	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	21970873, 28854215, 29162097, 31451731, 36730426, 37224811	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital glucose-galactose malabsorption	Congenital glucose-galactose malabsorption	BEFREE	27684496		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Heart Defects	Congenital heart defects	BEFREE	19471316		★★★★★ ★☆☆☆☆ Found in Text Mining only
Corneal Neovascularization	Corneal Neovascularization	BEFREE	26348636, 27233452		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	29947772		★★★★★ ★☆☆☆☆ Found in Text Mining only
Demyelinating Diseases	Demyelinating Diseases	BEFREE	29931031		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	27684496, 28060188, 30565672		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	32390949	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	36313769	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	27684496, 28060188, 30565672		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus	Diabetes mellitus	Pubtator	28060188, 31010169	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	20081858, 21103350, 28060188, 31010169, 34209638	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	CTD_human_DG	20081858		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	21103350, 22992776, 23274905, 27684496, 28060188, 31010169		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	GWASDB_DG	22885922		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	GWASCAT_DG	28869590, 29358691, 30054458, 30595370		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	17533110, 21452064, 30396930		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	17533110, 21452064, 30396930		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	LHGDN	17533110		★★★★★ ★☆☆☆☆ Found in Text Mining only
Focal Cortical Dysplasia	Focal cortical dysplasia	Pubtator	20452788	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Follicular thyroid carcinoma	Follicular Thyroid Carcinoma	BEFREE	29371975, 31060342, 31717665		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	27626492, 28035380, 30135192		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	27626492	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	27626492, 28035380, 30135192		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	21559010, 30135192		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	21559010	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hamartoma Syndrome, Multiple	Hamartoma	BEFREE	29947772		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Defects Congenital	Congenital heart defect	Pubtator	19471316	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	19471316	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Failure Diastolic	Heart failure	Pubtator	33303070	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemangiosarcoma	Hemangiosarcoma	BEFREE	21909081, 22532251		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemangiosarcoma	Hemangiosarcoma	Pubtator	21909081, 22067331	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	12874782		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	16507917, 29059430	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	24122840	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	26631740		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	Pubtator	20185807	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoplastic Left Heart Syndrome	Hypoplastic Left Heart Syndrome	BEFREE	19471316		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoplastic Left Heart Syndrome	Hypoplastic left heart syndrome	Pubtator	19471316	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intestinal Cancer	Intestinal Cancer	BEFREE	28854215		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal disease	Pubtator	18455124	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intestinal Neoplasms	Intestinal Neoplasms	BEFREE	18455124, 25242330		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intestinal Neoplasms	Intestinal neoplasm	Pubtator	28854215	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	18580962, 20064070, 20730087, 23685018, 30318784		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	LHGDN	18580962		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kaposiform Hemangioendothelioma	Kaposiform Hemangioendothelioma	BEFREE	18580962		★★★★★ ★☆☆☆☆ Found in Text Mining only
Keratitis	Keratitis	BEFREE	26348636		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	17062673, 22982861, 23291986, 23505027, 25684142, 28646551, 29987895		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	17062673, 18400094		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	11719431, 18400094		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	18400094	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	18400094		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Neoplasms	Liver neoplasm	Pubtator	18400094	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	35281529	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	24797520, 35838046	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	31593555		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphedema	Lymphedema	Pubtator	30431105	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphohistiocytosis, Hemophagocytic	Lymphohistiocytosis	BEFREE	19471316		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	17415710, 29059430, 31213129		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	17533110, 21452064, 30396930		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	17217617		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	27476001		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	24982352, 26759228, 28854215, 30396930, 31560170		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	26609053		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	18455124, 20064070, 20453716, 23045246, 24647631, 24982352, 25526434, 27626492, 28854215, 29934628, 30135192, 30154153, 31451731, 31717665		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	12851706, 18455124, 23045246, 25242332		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	17415710		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medullary carcinoma of thyroid	Megalencephaly, Polymicrogyria, Polydactyly, Hydrocephalus Syndrome	BEFREE	26760117, 31001799		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	34209638	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	28919193		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	25526434	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	28333941		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	12874782, 17062673, 17069925, 17217617, 17415710, 17533110, 18400094, 18455124, 18580962, 21559010, 22508481, 22562155, 23045246, 24647631, 24981766 View all (14 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	20453716, 22508481		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	23818313		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	23818313, 34890032	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteonecrosis	Osteonecrosis	Pubtator	26590194	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	35030967	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	16525637		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	LHGDN	16525637		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	35786664	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	Pubtator	38273351	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	26609053, 26760117, 29371975		★★★★★ ★☆☆☆☆ Found in Text Mining only
Paraganglioma	Paraganglioma	Pubtator	22067331	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	27476001		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	34583623	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	Pubtator	36459642	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Right ventricle hypoplasia	Right ventricle hypoplasia	Pubtator	19471316	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Kaposi	Sarcoma	Pubtator	20064070, 22067331, 22719258, 32518203, 32518204	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Synovial	Synovial sarcoma	Pubtator	22067331	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	23898075		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sporadic Breast Carcinoma	Breast Carcinoma	BEFREE	17415710		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	22143938, 24647631, 31717665		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	21452064, 26310281		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	24647631, 34791715, 36811957	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	25526434	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	24982352, 26759228, 28854215, 30396930, 31560170		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	25706394, 28854215, 31560170	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombasthenia	Thrombasthenia	Pubtator	37486381	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid cancer follicular	Follicular thyroid cancer	Pubtator	31060342, 31717665	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	30061172	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid cancer, follicular	Thyroid cancer	BEFREE	31717665		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	26609053, 29371975		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	26609053		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	30061172, 31060342	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	22529986	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	28351298	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Neoplasms	Vascular neoplasm	BEFREE	18580962, 20064070		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Neoplasms	Vascular neoplasm	LHGDN	18580962		★★★★★ ★☆☆☆☆ Found in Text Mining only

PROX1 (prospero homeobox 1)