KYAT3 (kynurenine aminotransferase 3)

Gene

• Entrez ID: 56267
• Gene name: Kynurenine aminotransferase 3
• Gene symbol: KYAT3
• Synonyms (NCBI Gene): CCBL2, KAT3, KATIII
• Chromosome: 1
• Chromosome location: 1p22.2
• Summary: This gene encodes an aminotransferase that transaminates kynurenine to form kynurenic acid, which is a metabolite of tryptophan. Multiple alternatively spliced transcript variants that encode different proteins have been described for this gene. This gene

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT544244	hsa-miR-208a-5p	PAR-CLIP	21572407
MIRT544243	hsa-miR-208b-5p	PAR-CLIP	21572407
MIRT544242	hsa-miR-369-3p	PAR-CLIP	21572407
MIRT544241	hsa-miR-5692b	PAR-CLIP	21572407
MIRT544240	hsa-miR-5692c	PAR-CLIP	21572407
MIRT544239	hsa-miR-4491	PAR-CLIP	21572407
MIRT544238	hsa-miR-4657	PAR-CLIP	21572407
MIRT544237	hsa-miR-299-3p	PAR-CLIP	21572407
MIRT544236	hsa-miR-1915-5p	PAR-CLIP	21572407
MIRT544235	hsa-miR-496	PAR-CLIP	21572407
MIRT544233	hsa-miR-4480	PAR-CLIP	21572407
MIRT544234	hsa-miR-7847-3p	PAR-CLIP	21572407
MIRT544232	hsa-miR-6793-5p	PAR-CLIP	21572407
MIRT544231	hsa-miR-374a-5p	PAR-CLIP	21572407
MIRT544230	hsa-miR-374b-5p	PAR-CLIP	21572407
MIRT544229	hsa-miR-192-3p	PAR-CLIP	21572407

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003723	Function	RNA binding	HDA	22681889
GO:0005737	Component	Cytoplasm	IBA
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IBA
GO:0006103	Process	2-oxoglutarate metabolic process	IEA
GO:0006520	Process	Amino acid metabolic process	IEA
GO:0006520	Process	Amino acid metabolic process	ISS
GO:0008483	Function	Transaminase activity	IEA
GO:0016212	Function	Kynurenine-oxoglutarate transaminase activity	IBA
GO:0016212	Function	Kynurenine-oxoglutarate transaminase activity	IEA
GO:0016212	Function	Kynurenine-oxoglutarate transaminase activity	ISS
GO:0016740	Function	Transferase activity	IEA
GO:0016829	Function	Lyase activity	IEA
GO:0030170	Function	Pyridoxal phosphate binding	IEA
GO:0042803	Function	Protein homodimerization activity	IEA
GO:0047315	Function	Kynurenine-glyoxylate transaminase activity	IEA
GO:0047315	Function	Kynurenine-glyoxylate transaminase activity	ISS
GO:0047804	Function	Cysteine-S-conjugate beta-lyase activity	IEA
GO:0070189	Process	Kynurenine metabolic process	IEA
GO:0070189	Process	Kynurenine metabolic process	ISS
GO:0097053	Process	L-kynurenine catabolic process	IEA

Other IDs

• MIM: 610656
• HGNC: 33238
• e!Ensembl: ENSG00000137944

Protein

• UniProt ID: Q6YP21
• Protein name: Kynurenine--oxoglutarate transaminase 3 (EC 2.6.1.7) (Cysteine-S-conjugate beta-lyase 2) (EC 4.4.1.13) (Kynurenine aminotransferase 3) (Kynurenine aminotransferase III) (KATIII) (Kynurenine--glyoxylate transaminase) (EC 2.6.1.63) (Kynurenine--oxoglutarate
• Protein function: Catalyzes the irreversible transamination of the L-tryptophan metabolite L-kynurenine to form kynurenic acid (KA), an intermediate in the tryptophan catabolic pathway which is also a broad spectrum antagonist of the three ionotropic excitatory a
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00155	Aminotran_1_2	63 → 446	Aminotransferase class I and II	Domain

• Sequence:

  MFLAQRSLCSLSGRAKFLKTISSSKILGFSTSAKMSLKFTNAKRIEGLDSNVWIEFTKLA
  ADPSVVNLGQGFPDISPPTYVKEELSKIAAIDSLNQYTRGFGHPSLVKALSYLYEKLYQK
  QIDSNKEILVTVGAYGSLFNTIQALIDEGDEVILIVPFYDCYEPMVRMAGATPVFIPLRS
  KPVYGKRWSSSDWTLDPQELESKFNSKTKAIILNTPHNPLGKVYNREELQVIADLCIKYD
  TLCISDEVYEWLVYSGNKHLKIATFPGMWERTITIGSAGKTFSVTGWKLGWSIGPNHLIK
  HLQTVQQNTIYTCATPLQEALAQAFWIDIKRMDDPECYFNSLPKELEVKRDRMVRLLESV
  GLKPIVPDGGYFIIADVSLLDPDLSDMKNNEPYDYKFVKWMTKHKKLSAIPVSAFCNSET
  KSQFEKFVRFCFIKKDSTLDAAEEIIKAWSVQKS

• Sequence length: 454

Pathways

KEGG:

Cysteine and methionine metabolism
Tryptophan metabolism
Selenocompound metabolism
Metabolic pathways

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
CARDIOVASCULAR DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSION, SINGLE EPISODE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UNIPOLAR DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Anorexia Nervosa	Anorexia nervosa	Pubtator	33498837	Associate	★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	25346392		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	35771747	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	31666808		★☆☆☆☆ Found in Text Mining only
Hyperoxaluria	Hyperoxaluria	BEFREE	30907303		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	24720539		★☆☆☆☆ Found in Text Mining only
Major depression, single episode	Mental Depression	PSYGENET_DG	21492941		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Major Depressive Disorder	Mental Depression	PSYGENET_DG	21492941		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant Neoplasms	Malignant Neoplasm	BEFREE	29596326		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	21845542	Associate	★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	26347385	Associate	★☆☆☆☆ Found in Text Mining only
Primary Hyperoxaluria	Hyperoxaluria	BEFREE	30907303		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	LHGDN	19165527		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	31666808		★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	PSYGENET_DG	21492941		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uveal melanoma	Uveal melanoma	Pubtator	21845542	Associate	★☆☆☆☆ Found in Text Mining only