Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	5626
Gene name	PROP paired-like homeobox 1
Gene symbol	PROP1
Synonyms (NCBI Gene)	CPHD2PROP-1
Chromosome	5
Chromosome location	5q35.3
Summary	This gene encodes a paired-like homeodomain transcription factor in the developing pituitary gland. Expression occurs prior to and is required for expression of pou domain transcription factor 1, which is responsible for pituitary development and hormone

Show/Hide all (37)

SNP ID	Visualize variation	Clinical significance	Consequence
rs121917839	G>A	Likely-pathogenic	Coding sequence variant, missense variant
rs121917840	A>G,T	Likely-pathogenic	Coding sequence variant, missense variant
rs121917841	A>G	Pathogenic	Coding sequence variant, missense variant
rs121917842	C>T	Pathogenic	Coding sequence variant, missense variant
rs121917843	G>A	Pathogenic	Coding sequence variant, missense variant
rs121917844	G>A	Pathogenic	Stop gained, coding sequence variant
rs121917845	C>T	Likely-pathogenic	Stop gained, coding sequence variant
rs137853100	C>T	Pathogenic, uncertain-significance	Coding sequence variant, missense variant
rs140016178	G>A,C	Likely-pathogenic	Stop gained, coding sequence variant, missense variant
rs144314831	C>A,T	Conflicting-interpretations-of-pathogenicity	Synonymous variant, coding sequence variant
rs145883811	G>A,C	Conflicting-interpretations-of-pathogenicity, uncertain-significance	Synonymous variant, stop gained, coding sequence variant
rs193922688	TC>-	Pathogenic	Frameshift variant, coding sequence variant
rs200977367	G>A	Conflicting-interpretations-of-pathogenicity	Coding sequence variant, synonymous variant
rs587776681	TC>-	Pathogenic	Coding sequence variant, frameshift variant
rs587776682	GGAGCACTCGAGT>-	Pathogenic	Coding sequence variant, frameshift variant
rs587776683	T>-	Pathogenic	Coding sequence variant, frameshift variant
rs758911793	A>G	Conflicting-interpretations-of-pathogenicity	Coding sequence variant, synonymous variant
rs762529663	G>-	Likely-pathogenic	Coding sequence variant, frameshift variant
rs766673446	G>A,C	Likely-pathogenic	Coding sequence variant, stop gained, missense variant
rs769171020	C>T	Likely-pathogenic	Coding sequence variant, missense variant
rs775353413	C>T	Uncertain-significance, conflicting-interpretations-of-pathogenicity	Coding sequence variant, missense variant
rs786204663	G>-	Likely-pathogenic	Coding sequence variant, frameshift variant
rs794726693	G>A	Likely-pathogenic	Coding sequence variant, stop gained
rs1057516832	GA>-	Likely-pathogenic	Coding sequence variant, frameshift variant
rs1057516846	T>C	Likely-pathogenic	Splice acceptor variant
rs1057517027	TG>-	Likely-pathogenic	Coding sequence variant, frameshift variant
rs1057517041	T>A	Likely-pathogenic	Splice acceptor variant
rs1057517424	->G	Likely-pathogenic	Coding sequence variant, frameshift variant
rs1064797071	C>G	Likely-pathogenic	Initiator codon variant, missense variant
rs1214465435	C>A	Likely-pathogenic	Splice donor variant
rs1436089021	C>T	Likely-pathogenic	Splice donor variant
rs1554182405	->GC	Likely-pathogenic	Coding sequence variant, frameshift variant
rs1554182481	G>A	Likely-pathogenic	Coding sequence variant, stop gained
rs1554182507	->C	Likely-pathogenic	Coding sequence variant, frameshift variant
rs1554182514	->C	Likely-pathogenic	Coding sequence variant, frameshift variant
rs1554182632	->TC	Likely-pathogenic	Coding sequence variant, frameshift variant
rs1554182645	A>G	Likely-pathogenic	Initiator codon variant, missense variant

Show/Hide all (21)

miRTarBase ID	miRNA	Experiments	Reference
MIRT731114	hsa-miR-593-3p	Western blotLuciferase reporter assay	25434367
MIRT731114	hsa-miR-593-3p	Western blotLuciferase reporter assay	25434367
MIRT731114	hsa-miR-593-3p	Western blotLuciferase reporter assay	25434367
MIRT731114	hsa-miR-593-3p	Western blotLuciferase reporter assay	25434367
MIRT731115	hsa-miR-511-5p	Western blotLuciferase reporter assay	25434367
MIRT731115	hsa-miR-511-5p	Western blotLuciferase reporter assay	25434367
MIRT731115	hsa-miR-511-5p	Western blotLuciferase reporter assay	25434367
MIRT731115	hsa-miR-511-5p	Western blotLuciferase reporter assay	25434367
MIRT1265180	hsa-miR-1276	CLIP-seq
MIRT1265181	hsa-miR-197	CLIP-seq
MIRT1265182	hsa-miR-2110	CLIP-seq
MIRT1265183	hsa-miR-3157-5p	CLIP-seq
MIRT1265184	hsa-miR-3171	CLIP-seq
MIRT1265185	hsa-miR-3202	CLIP-seq
MIRT1265186	hsa-miR-4271	CLIP-seq
MIRT1265187	hsa-miR-4691-3p	CLIP-seq
MIRT1265188	hsa-miR-4695-3p	CLIP-seq
MIRT1265189	hsa-miR-4724-5p	CLIP-seq
MIRT1265190	hsa-miR-4725-3p	CLIP-seq
MIRT1265191	hsa-miR-4747-5p	CLIP-seq
MIRT1265192	hsa-miR-580	CLIP-seq

Show/Hide all (35)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IEA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA
GO:0001568	Process	Blood vessel development	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003682	Function	Chromatin binding	IEA
GO:0005515	Function	Protein binding	IPI	23732115, 32296183, 36217029
GO:0005634	Component	Nucleus	IEA
GO:0005667	Component	Transcription regulator complex	IBA
GO:0005667	Component	Transcription regulator complex	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006915	Process	Apoptotic process	IEA
GO:0007399	Process	Nervous system development	IEA
GO:0007417	Process	Central nervous system development	TAS	9462743
GO:0008013	Function	Beta-catenin binding	IEA
GO:0009887	Process	Animal organ morphogenesis	IEA
GO:0009953	Process	Dorsal/ventral pattern formation	IEA
GO:0016477	Process	Cell migration	IEA
GO:0021979	Process	Hypothalamus cell differentiation	IEA
GO:0021983	Process	Pituitary gland development	IEA
GO:0021983	Process	Pituitary gland development	IEA
GO:0021984	Process	Adenohypophysis development	IEA
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0048732	Process	Gland development	IEA
GO:0048850	Process	Hypophysis morphogenesis	IEA
GO:0060126	Process	Somatotropin secreting cell differentiation	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

MIM	HGNC	e!Ensembl
601538	9455	ENSG00000175325

O75360

Protein name

Homeobox protein prophet of Pit-1 (PROP-1) (Pituitary-specific homeodomain factor)

Protein function

Possibly involved in the ontogenesis of pituitary gonadotropes, as well as somatotropes, lactotropes and caudomedial thyrotropes.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00046	Homeodomain	70 → 126	Homeodomain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed specifically in embryonic pituitary.

Sequence

MEAERRRQAEKPKKGRVGSNLLPERHPATGTPTTTVDSSAPPCRRLPGAGGGRSRFSPQG
GQRGRPHSRRRHRTTFSPVQLEQLESAFGRNQYPDIWARESLARDTGLSEARIQVWFQNR
RAKQRKQERSLLQPLAHLSPAAFSSFLPESTACPYSYAAPPPPVTCFPHPYSHALPSQPS
TGGAFALSHQSEDWYPTLHPAPAGHLPCPPPPPMLPLSLEPSKSWN

Sequence length

226

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (5)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
46,XY partial gonadal dysgenesis	Likely pathogenic; Pathogenic	rs193922688	RCV002254517	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Combined pituitary hormone deficiencies, genetic form	Likely pathogenic; Pathogenic	rs193922688, rs587776683, rs137853100, rs140016178	RCV000030379 RCV005406731 RCV003317030 RCV000030381	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Pituitary hormone deficiency	Likely pathogenic; Pathogenic	rs193922688, rs146918863	RCV005865172 RCV005865376	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Pituitary hormone deficiency, combined, 2	Likely pathogenic; Pathogenic	rs2113064591, rs780134343, rs761018422, rs2480285098, rs794726693, rs766673446, rs786204663, rs2480292680, rs121917839, rs121917840, rs587776681, rs193922688, rs121917841, rs587776682, rs587776683 View all (28 more)	RCV003462993 RCV003462988 RCV003464401 RCV002283886 RCV000148938 View all (40 more)	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
PROP1-related disorder	Likely pathogenic; Pathogenic	rs193922688, rs140016178	RCV004755724 RCV003415746	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (13)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Amenorrhea	Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COMBINED PITUITARY HORMONE DEFICIENCIES, GENETIC FORMS	—	Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COMBINED PITUITARY HORMONE DEFICIENCY GENETIC FORM	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Combined Pituitary Hormone Deficiency, Recessive	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DESBUQUOIS SYNDROME	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Disorder of sexual differentiation	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GENETIC PANHYPOPITUITARISM	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOGONADISM	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOPITUITARISM	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOTHYROIDISM DUE TO DEFICIENT TRANSCRIPTION FACTORS INVOLVED IN PITUITARY DEVELOPMENT OR FUNCTION	—	GWAS catalog, Orphanet GWAS catalog, Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOTHYROIDISM DUE TO MUTATION IN TRANSCRIPTION FACTOR OF PITUITARY DEVELOPMENT	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PANHYPOPITUITARISM	—	Disgenet, GenCC Disgenet, GenCC	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PITUITARY DWARFISM TYPE 3	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (92)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
ACTH-Secreting Pituitary Adenoma	Pituitary adenoma	BEFREE	10902805		★★★★★ ★☆☆☆☆ Found in Text Mining only
Addison Disease	Addison`s Disease	BEFREE	11022176		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	10404841, 10902805, 23778486		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenal cortical hypofunction	Adrenal Cortical Hypofunction	BEFREE	11022176, 15472232		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenocorticotropic hormone (ACTH) deficiency (disorder)	Adrenocorticotropic Hormone Deficiency	BEFREE	10902805, 12780757, 12914740, 17162714		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenogenital Syndrome	Adrenogenital Syndrome	BEFREE	31028847		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Craniopharyngioma	Craniopharyngioma	BEFREE	21761366, 23831233		★★★★★ ★☆☆☆☆ Found in Text Mining only
Agenesis of corpus callosum	Agenesis Of Corpus Callosum	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
alpha 1-Antitrypsin Deficiency	Alpha 1-Antitrypsin Deficiency	BEFREE	31028847		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amenorrhea	Amenorrhea	Pubtator	23624138, 36984475	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain Neoplasms	Brain Neoplasms	BEFREE	10404841		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomegaly	Cardiomegaly	Pubtator	17698542, 30988269	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Central hypothyroidism	Central hypothyroidism	BEFREE	12914740, 15012608, 18174732, 23652424		★★★★★ ★☆☆☆☆ Found in Text Mining only
Central hypothyroidism	Central hypothyroidism	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebellar Hypoplasia	Cerebellar Hypoplasia	BEFREE	12914740		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	27226307		★★★★★ ★☆☆☆☆ Found in Text Mining only
Combined pituitary hormone deficiencies, genetic forms	Pituitary Hormone Deficiency	Orphanet			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Combined Pituitary Hormone Deficiency	Combined pituitary hormone deficiency	Pubtator	12153609, 15302300, 17162714, 17698542, 22111336, 23624138, 23652424, 26059845, 26608600, 28356564, 29255988, 30988269, 31948187, 32612575, 36984475, 9745452 View all (1 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital adrenal hyperplasia	Congenital adrenal hyperplasia	BEFREE	31028847		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital exomphalos	Congenital Exomphalos	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital hypoplasia of adrenal gland	Congenital adrenal hypoplasia	BEFREE	12536356		★★★★★ ★☆☆☆☆ Found in Text Mining only
Craniopharyngioma	Craniopharyngioma	BEFREE	21761366, 22086512, 23831233		★★★★★ ★☆☆☆☆ Found in Text Mining only
Craniopharyngioma	Craniopharyngioma	Pubtator	22086512	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Developmental disability	Pubtator	23624138	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dwarfism	Dwarfism	BEFREE	10687855, 12519826, 15531542, 16556738, 16794371, 16909451, 19690401, 20679996, 23831233, 24155868, 28425851, 28452585		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dwarfism	Dwarfism	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Dwarfism Pituitary	Pituitary dwarfism	Pubtator	22111336, 23652424, 30988269, 31948187	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyssomnias	Dyssomnia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Ectopic anterior pituitary gland	Ectopic anterior pituitary gland	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Endocrine System Diseases	Endocrine System Diseases	BEFREE	11371507		★★★★★ ★☆☆☆☆ Found in Text Mining only
Follicle stimulating hormone deficiency	Follicle Stimulating Hormone Deficiency	BEFREE	18174732		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	10404841		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	23831233		★★★★★ ★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Growth Disorders	Growth disorder	Pubtator	23624138	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatolenticular Degeneration	Hepatolenticular Degeneration	BEFREE	31028847		★★★★★ ★☆☆☆☆ Found in Text Mining only
Holoprosencephaly	Holoprosencephaly	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipidemia	Hyperlipidemia	BEFREE	23624138		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoglycemic seizures	Hypoglycemic seizures	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypogonadism	Hypogonadism	LHGDN	15941866		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypogonadism	Hypogonadism	Pubtator	31948187	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypogonadism	Hypogonadism	HPO_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypogonadism, Isolated Hypogonadotropic	Hypogonadism	BEFREE	15941866		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypogonadotropic hypogonadism	Hypogonadotropic Hypogonadism	BEFREE	10527669, 10599708, 10714361, 10727999, 15941866, 23499866		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypogonadotropic hypogonadism	Hypogonadotropic Hypogonadism	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypopituitarism	Hypopituitarism	BEFREE	12717343, 14530604, 15531542, 15963055, 16556738, 29180983		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypopituitarism	Hypopituitarism	Pubtator	17698542, 34124982	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypothyroidism	Hypothyroidism	BEFREE	12914740, 15012608, 18174732		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	Pubtator	23624138, 23652424, 31948187, 32319661	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypothyroidism due to deficient transcription factors involved in pituitary development or function	Hypothyroidism	Orphanet			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Insulin-Like Growth Factor I Deficiency	Insulin-Like Growth Factor I Deficiency	BEFREE	15621211		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Isolated somatotropin deficiency	Isolated Somatotropin Deficiency	BEFREE	16759034, 17526936, 20396904, 25557026		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kallmann Syndrome	Kallmann Syndrome	BEFREE	10714361		★★★★★ ★☆☆☆☆ Found in Text Mining only
Laron Syndrome	Laron Syndrome	BEFREE	15621211		★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	10404841		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neonatal hypoglycemia	Hypoglycemia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11371507, 22086512, 29207641		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-acquired panhypopituitarism	Non-Acquired Panhypopituitarism	Orphanet			★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	29158850		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	12536356		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oral cleft	Oral cleft	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	15621211		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	23624138		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	23624138	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis of vertebrae	Osteoporosis of vertebrae	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Panhypopituitarism	Panhypopituitarism	BEFREE	10404841, 10549300, 10902805, 10946868, 10946881, 11022176, 11081182, 11134108, 11549674, 12519826, 12717343, 12780757, 12812307, 12932747, 15192287 View all (36 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Panhypopituitarism	Panhypopituitarism	ORPHANET_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Panhypopituitarism	Panhypopituitarism	HPO_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	BEFREE	31464415		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pituitary Diseases	Pituitary Diseases	BEFREE	15126542, 22086512, 23831233		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pituitary dwarfism	Pituitary dwarfism	BEFREE	20694410, 25557026		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pituitary dwarfism	Pituitary dwarfism	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Pituitary Dwarfism Type 3	Pituitary dwarfism	CLINVAR_DG	10084575, 10323394, 10634415, 11081182, 11549674, 12153609, 14614227, 15126542, 15472175, 15472232, 15531542, 15941866, 15963055, 16131601, 16735499 View all (18 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pituitary Dwarfism Type 3	Pituitary dwarfism	UNIPROT_DG	10946881, 11549703, 12519826, 15531542, 19128366, 9462743, 9768691		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pituitary Dwarfism Type 3	Pituitary dwarfism	GENOMICS_ENGLAND_DG	16984240		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pituitary Dwarfism Type 3	Pituitary dwarfism	CTD_human_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pituitary Hormone Deficiency, Combined, 1	Pituitary Hormone Deficiency	ORPHANET_DG	9462743		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary neoplasm	Pubtator	23778486, 31948187	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polydactyly	Polydactyly	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Refractory anemias	Anemia	BEFREE	29356182		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	29356182		★★★★★ ★☆☆☆☆ Found in Text Mining only
Secondary hypothyroidism	Hypothyroidism	BEFREE	12914740, 15941866, 18174732		★★★★★ ★☆☆☆☆ Found in Text Mining only
Secondary hypothyroidism	Hypothyroidism	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Septo-Optic Dysplasia	Septo-Optic Dysplasia	BEFREE	10727999, 15670191, 17315526, 20694410, 26111865		★★★★★ ★☆☆☆☆ Found in Text Mining only
Septo-Optic Dysplasia	Septo-Optic Dysplasia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Disorders	Sleep Disorders	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Somatotropin deficiency	Somatotropin Deficiency	BEFREE	17526936		★★★★★ ★☆☆☆☆ Found in Text Mining only
X-linked Adrenal Hypoplasia	Adrenal Hypoplasia, X-Linked	BEFREE	12536356		★★★★★ ★☆☆☆☆ Found in Text Mining only

PROP1 (PROP paired-like homeobox 1)