Gene Gene information from NCBI Gene database.
Entrez ID 56259
Gene name Catenin beta like 1
Gene symbol CTNNBL1
Synonyms (NCBI Gene)
C20orf33IMD99NAPP14LPP8304dJ633O20.1
Chromosome 20
Chromosome location 20q11.23
Summary The protein encoded by this gene is a component of the pre-mRNA-processing factor 19-cell division cycle 5-like (PRP19-CDC5L) protein complex, which activates pre-mRNA splicing and is an integral part of the spliceosome. The encoded protein is also a nucl
miRNA miRNA information provided by mirtarbase database.
54
miRTarBase ID miRNA Experiments Reference
MIRT020731 hsa-miR-155-5p Proteomics 18668040
MIRT050320 hsa-miR-25-3p CLASH 23622248
MIRT049224 hsa-miR-92a-3p CLASH 23622248
MIRT045603 hsa-miR-149-5p CLASH 23622248
MIRT044639 hsa-miR-320a CLASH 23622248
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
23
GO ID Ontology Definition Evidence Reference
GO:0000398 Process MRNA splicing, via spliceosome NAS 23742842
GO:0000974 Component Prp19 complex IDA 15175653
GO:0000974 Component Prp19 complex IPI 20176811
GO:0002250 Process Adaptive immune response IEA
GO:0002376 Process Immune system process IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
611537 15879 ENSG00000132792
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8WYA6
Protein name Beta-catenin-like protein 1 (Nuclear-associated protein) (NAP) (Testis development protein NYD-SP19)
Protein function Component of the PRP19-CDC5L complex that forms an integral part of the spliceosome and is required for activating pre-mRNA splicing. Participates in AID/AICDA-mediated somatic hypermutation (SHM) and class-switch recombination (CSR), 2 processe
PDB 4CB8 , 4CB9 , 4CBA , 4HM9 , 4HNM , 4MFU , 4MFV , 7ABI
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF08216 CTNNBL 57 162 Catenin-beta-like, Arm-motif containing nuclear Domain
Tissue specificity TISSUE SPECIFICITY: Widely expressed with highest levels in skeletal muscle, placenta, heart, spleen, testis and thyroid. {ECO:0000269|PubMed:12659813}.
Sequence
MDVGELLSYQPNRGTKRPRDDEEEEQKMRRKQTGTRERGRYREEEMTVVEEADDDKKRLL
QIIDRDGEEEEEEEEPLDESSVKKMILTFEKRSYKNQELRIKFPDNPEKFMESELDLNDI
IQEMHVVATMPDLYHLLVELNAVQSLLGLLGHDNTDVSIAVV
DLLQELTDIDTLHESEEG
AEVLIDALVDGQVVALLVQNLERLDESVKEEADGVHNTLAIVENMAEFRPEMCTEGAQQG
LLQWLLKRLKAKMPFDANKLYCSEVLAILLQDNDENRELLGELDGIDVLLQQLSVFKRHN
PSTAEEQEMMENLFDSLCSCLMLSSNRERFLKGEGLQLMNLMLREKKISRSSALKVLDHA
MIGPEGTDNCHKFVDILGLRTIFPLFMKSPRKIKKVGTTEKEHEEHVCSILASLLRNLRG
QQRTRLLNKFTENDSEKVDRLMELHFKYLGAMQVADKKIEGEKHDMVRRGEIIDNDTEEE
FYLRRLDAGLFVLQHICYIMAEICNANVPQIRQRVHQILNMRGSSIKIVRHIIKEYAENI
GDGRSPEFRENEQKRILGLLENF
Sequence length 563
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Spliceosome   mRNA Splicing - Major Pathway
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
15
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
Acute myeloid leukemia Likely benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
ALZHEIMER DISEASE GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
BRCAX BREAST CANCER GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Cervical cancer Likely benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Adrenal Gland Pheochromocytoma Adrenal Gland Pheochromocytoma BEFREE 30417779
★☆☆☆☆
Found in Text Mining only
Amyloidosis Amyloidosis BEFREE 17478890
★☆☆☆☆
Found in Text Mining only
Anxiety Anxiety Disorder BEFREE 26553741
★☆☆☆☆
Found in Text Mining only
Anxiety Disorders Anxiety Disorder BEFREE 26553741
★☆☆☆☆
Found in Text Mining only
Asthma Asthma BEFREE 28608279
★☆☆☆☆
Found in Text Mining only
Atrial Fibrillation Atrial Fibrillation BEFREE 29602862
★☆☆☆☆
Found in Text Mining only
Autistic Disorder Autism BEFREE 30664622
★☆☆☆☆
Found in Text Mining only
Blindness Blindness Pubtator 19463995 Associate
★☆☆☆☆
Found in Text Mining only
Carcinoma of lung Lung carcinoma BEFREE 30214604
★☆☆☆☆
Found in Text Mining only
Carcinoma, Ovarian Epithelial Ovarian Epithelial carcinoma BEFREE 28501461
★☆☆☆☆
Found in Text Mining only