Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	56241
Gene name	Sushi domain containing 2
Gene symbol	SUSD2
Synonyms (NCBI Gene)	BK65A6.2W5C5
Chromosome	22
Chromosome location	22q11.23

136

Show/Hide all (136)

miRTarBase ID	miRNA	Experiments	Reference
MIRT722813	hsa-miR-1266-5p	HITS-CLIP	19536157
MIRT722812	hsa-miR-4518	HITS-CLIP	19536157
MIRT722811	hsa-miR-3934-3p	HITS-CLIP	19536157
MIRT722810	hsa-miR-296-5p	HITS-CLIP	19536157
MIRT722809	hsa-miR-6798-5p	HITS-CLIP	19536157
MIRT722808	hsa-miR-4707-5p	HITS-CLIP	19536157
MIRT722807	hsa-miR-4772-5p	HITS-CLIP	19536157
MIRT732657	hsa-miR-141-3p	Immunoprecipitaion (IP)Luciferase reporter assayqRT-PCR	33836533
MIRT722813	hsa-miR-1266-5p	HITS-CLIP	19536157
MIRT722812	hsa-miR-4518	HITS-CLIP	19536157
MIRT722811	hsa-miR-3934-3p	HITS-CLIP	19536157
MIRT722810	hsa-miR-296-5p	HITS-CLIP	19536157
MIRT722809	hsa-miR-6798-5p	HITS-CLIP	19536157
MIRT722808	hsa-miR-4707-5p	HITS-CLIP	19536157
MIRT722807	hsa-miR-4772-5p	HITS-CLIP	19536157
MIRT1403959	hsa-let-7a	CLIP-seq
MIRT1403960	hsa-let-7b	CLIP-seq
MIRT1403961	hsa-let-7c	CLIP-seq
MIRT1403962	hsa-let-7d	CLIP-seq
MIRT1403963	hsa-let-7e	CLIP-seq
MIRT1403964	hsa-let-7f	CLIP-seq
MIRT1403965	hsa-let-7g	CLIP-seq
MIRT1403966	hsa-let-7i	CLIP-seq
MIRT1403967	hsa-miR-1200	CLIP-seq
MIRT1403968	hsa-miR-1207-5p	CLIP-seq
MIRT1403969	hsa-miR-122	CLIP-seq
MIRT1403970	hsa-miR-1231	CLIP-seq
MIRT1403971	hsa-miR-125a-3p	CLIP-seq
MIRT1403972	hsa-miR-1294	CLIP-seq
MIRT1403973	hsa-miR-1297	CLIP-seq
MIRT1403974	hsa-miR-1321	CLIP-seq
MIRT1403975	hsa-miR-1343	CLIP-seq
MIRT1403976	hsa-miR-1915	CLIP-seq
MIRT1403977	hsa-miR-202	CLIP-seq
MIRT1403978	hsa-miR-24	CLIP-seq
MIRT1403979	hsa-miR-2467-5p	CLIP-seq
MIRT1403980	hsa-miR-26a	CLIP-seq
MIRT1403981	hsa-miR-26b	CLIP-seq
MIRT1403982	hsa-miR-3127-5p	CLIP-seq
MIRT1403983	hsa-miR-3150a-3p	CLIP-seq
MIRT1403984	hsa-miR-3155	CLIP-seq
MIRT1403985	hsa-miR-3155b	CLIP-seq
MIRT1403986	hsa-miR-3175	CLIP-seq
MIRT1403987	hsa-miR-3180-5p	CLIP-seq
MIRT1403988	hsa-miR-3188	CLIP-seq
MIRT1403989	hsa-miR-3200-5p	CLIP-seq
MIRT1403990	hsa-miR-326	CLIP-seq
MIRT1403991	hsa-miR-330-5p	CLIP-seq
MIRT1403992	hsa-miR-331-5p	CLIP-seq
MIRT1403993	hsa-miR-365	CLIP-seq
MIRT1403994	hsa-miR-3663-5p	CLIP-seq
MIRT1403995	hsa-miR-3664-3p	CLIP-seq
MIRT1403996	hsa-miR-3673	CLIP-seq
MIRT1403997	hsa-miR-3714	CLIP-seq
MIRT1403998	hsa-miR-3914	CLIP-seq
MIRT1403999	hsa-miR-3918	CLIP-seq
MIRT1404000	hsa-miR-3934	CLIP-seq
MIRT1404001	hsa-miR-3975	CLIP-seq
MIRT1404002	hsa-miR-4270	CLIP-seq
MIRT1404003	hsa-miR-4278	CLIP-seq
MIRT1404004	hsa-miR-4324	CLIP-seq
MIRT1404005	hsa-miR-4326	CLIP-seq
MIRT1404006	hsa-miR-4436a	CLIP-seq
MIRT1404007	hsa-miR-4437	CLIP-seq
MIRT1404008	hsa-miR-4441	CLIP-seq
MIRT1404009	hsa-miR-4450	CLIP-seq
MIRT1404010	hsa-miR-4458	CLIP-seq
MIRT1404011	hsa-miR-4465	CLIP-seq
MIRT1404012	hsa-miR-4500	CLIP-seq
MIRT1404013	hsa-miR-4514	CLIP-seq
MIRT1404014	hsa-miR-4648	CLIP-seq
MIRT1404015	hsa-miR-4649-3p	CLIP-seq
MIRT1404016	hsa-miR-4654	CLIP-seq
MIRT1404017	hsa-miR-4667-5p	CLIP-seq
MIRT1404018	hsa-miR-4678	CLIP-seq
MIRT1404019	hsa-miR-4692	CLIP-seq
MIRT1404020	hsa-miR-4700-5p	CLIP-seq
MIRT1404021	hsa-miR-4711-5p	CLIP-seq
MIRT1404022	hsa-miR-4716-3p	CLIP-seq
MIRT1404023	hsa-miR-4726-3p	CLIP-seq
MIRT1404024	hsa-miR-4728-5p	CLIP-seq
MIRT1404025	hsa-miR-4739	CLIP-seq
MIRT1404026	hsa-miR-4753-3p	CLIP-seq
MIRT1404027	hsa-miR-4756-5p	CLIP-seq
MIRT1404028	hsa-miR-4763-3p	CLIP-seq
MIRT1404029	hsa-miR-4765	CLIP-seq
MIRT1404030	hsa-miR-4768-5p	CLIP-seq
MIRT1404031	hsa-miR-4769-5p	CLIP-seq
MIRT1404032	hsa-miR-4793-3p	CLIP-seq
MIRT1404033	hsa-miR-484	CLIP-seq
MIRT1404034	hsa-miR-485-5p	CLIP-seq
MIRT1404035	hsa-miR-507	CLIP-seq
MIRT1404036	hsa-miR-520a-5p	CLIP-seq
MIRT1404037	hsa-miR-525-5p	CLIP-seq
MIRT1404038	hsa-miR-544b	CLIP-seq
MIRT1404039	hsa-miR-557	CLIP-seq
MIRT1404040	hsa-miR-609	CLIP-seq
MIRT1404041	hsa-miR-637	CLIP-seq
MIRT1404042	hsa-miR-760	CLIP-seq
MIRT1404043	hsa-miR-764	CLIP-seq
MIRT1404044	hsa-miR-939	CLIP-seq
MIRT1404045	hsa-miR-940	CLIP-seq
MIRT1404046	hsa-miR-98	CLIP-seq
MIRT1403969	hsa-miR-122	CLIP-seq
MIRT2121194	hsa-miR-1266	CLIP-seq
MIRT1403974	hsa-miR-1321	CLIP-seq
MIRT1403976	hsa-miR-1915	CLIP-seq
MIRT2121195	hsa-miR-2110	CLIP-seq
MIRT2121196	hsa-miR-2117	CLIP-seq
MIRT1403978	hsa-miR-24	CLIP-seq
MIRT1403983	hsa-miR-3150a-3p	CLIP-seq
MIRT1403984	hsa-miR-3155	CLIP-seq
MIRT1403985	hsa-miR-3155b	CLIP-seq
MIRT2121197	hsa-miR-3162-5p	CLIP-seq
MIRT1403995	hsa-miR-3664-3p	CLIP-seq
MIRT2121198	hsa-miR-4260	CLIP-seq
MIRT2121199	hsa-miR-4273	CLIP-seq
MIRT2121200	hsa-miR-4294	CLIP-seq
MIRT2121201	hsa-miR-4433	CLIP-seq
MIRT2121202	hsa-miR-4459	CLIP-seq
MIRT2121203	hsa-miR-4464	CLIP-seq
MIRT2121204	hsa-miR-4670-3p	CLIP-seq
MIRT1404023	hsa-miR-4726-3p	CLIP-seq
MIRT1404025	hsa-miR-4739	CLIP-seq
MIRT2121205	hsa-miR-4748	CLIP-seq
MIRT1404027	hsa-miR-4756-5p	CLIP-seq
MIRT2121206	hsa-miR-4768-3p	CLIP-seq
MIRT1404033	hsa-miR-484	CLIP-seq
MIRT2121207	hsa-miR-615-5p	CLIP-seq
MIRT2121208	hsa-miR-924	CLIP-seq
MIRT1403976	hsa-miR-1915	CLIP-seq
MIRT2395437	hsa-miR-2392	CLIP-seq
MIRT1404023	hsa-miR-4726-3p	CLIP-seq
MIRT2121207	hsa-miR-615-5p	CLIP-seq
MIRT2637008	hsa-miR-1178	CLIP-seq
MIRT2637009	hsa-miR-3907	CLIP-seq

Show/Hide all (8)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	23131994, 25351403, 32296183
GO:0005615	Component	Extracellular space	IBA
GO:0005886	Component	Plasma membrane	IDA	23131994
GO:0005886	Component	Plasma membrane	IEA
GO:0016020	Component	Membrane	IEA
GO:0051782	Process	Negative regulation of cell division	IDA	25351403
GO:0070062	Component	Extracellular exosome	HDA	19056867, 23533145
GO:1902807	Process	Negative regulation of cell cycle G1/S phase transition	IDA	25351403

MIM	HGNC	e!Ensembl
615825	30667	ENSG00000099994

Q9UGT4

Protein name

Sushi domain-containing protein 2

Protein function

May be a cytokine receptor for GPR15LG. May be a tumor suppressor; together with GPR15LG has a growth inhibitory effect on colon cancer cells which includes G1 cell cycle arrest (PubMed:25351403). May play a role in breast tumorigenesis (PubMed:

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01033	Somatomedin_B	29 → 64	Somatomedin B domain	Family
PF03782	AMOP	289 → 431	AMOP domain	Domain
PF00094	VWD	447 → 613	von Willebrand factor type D domain	Family
PF00084	Sushi	725 → 778	Sushi repeat (SCR repeat)	Domain

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in breast cancer, but shows a restricted expression pattern in normal tissues such as adipose, adrenal gland, kidney, lung, mammary gland, placenta, thyroid, trachea, and uterus (PubMed:23131994). Also expressed in col

Sequence

MKPALLPWALLLLATALGPGPGPTADAQESCSMRCGALDGPCSCHPTCSGLGTCCLDFRD
FCLEILPYSGSMMGGKDFVVRHFKMSSPTDASVICRFKDSIQTLGHVDSSGQVHCVSPLL
YESGRIPFTVSLDNGHSFPRAGTWLAVHPNKVSMMEKSELVNETRWQYYGTANTSGNLSL
TWHVKSLPTQTITIELWGYEETGMPYSQEWTAKWSYLYPLATHIPNSGSFTFTPKPAPPS
YQRWRVGALRIIDSKNYAGQKDVQALWTNDHALAWHLSDDFREDPVAWARTQCQAWEELE
DQLPNFLEELPDCPCTLTQARADSGRFFTDYGCDMEQGSVCTYHPGAVHCVRSVQASLRY
GSGQQCCYTADGTQLLTADSSGGSTPDRGHDWGAPPFRTPPRVPSMSHWLYDVLSFYYCC
LWAPDCPRYMQRRPSNDCRNYRPPRLASAFGDPHFVTFDGTNFTFNGRGEYVLLEAALTD
LRVQARAQPGTMSNGTETRGTGLTAVAVQEGNSDVVEVRLANRTGGLEVLLNQEVLSFTE
QSWMDLKGMFLSVAAGDRVSIMLASGAGLEVSVQGPFLSVSVLLPEKFLTHTHGLLGTLN
NDPTDDFTLHSGRVLPPGTSPQELFLFGANWTVHNASSLLTYDSWFLVHNFLYQPKHDPT
FEPLFPSETTLNPSLAQEAAKLCGDDHFCNFDVAATGSLSTGTATRVAHQLHQRRMQSLQ
PVVSCGWLAPPPNGQKEGNRYLAGSTIYFHCDNGYSLAGAETSTCQADGTWSSPTPKCQP
GRSYAVLLGIIFGGLAVVAAVALVYVLLRRRKGNTHVWGAQP

Sequence length

822

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
AMYOTROPHIC LATERAL SCLEROSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (34)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	23624525		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	GWASCAT_DG	23624525		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	GWASDB_DG	23624525		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Carcinoma	Breast Carcinoma	BEFREE	23131994, 28475599, 31387209		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	31387209	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	26815503		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	26815503	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	37328520	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	29759990, 30335544		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	25351403	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Microtia	Congenital microtia	Pubtator	37107637	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	26815503		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	GWASCAT_DG	29212778		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	28841682		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	28841682	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	33537815	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Defects Congenital	Congenital heart defect	Pubtator	37107637	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	26815503	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	23131994, 28475599, 31387209		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	28841682		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	26815503		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	29759990, 30335544		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	30259711		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	29305171		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	28475599		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	23131994, 26815503		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	29759990, 30335544		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	29759990, 32977853, 35894945	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	30335544	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	26815503		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	35259051	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	30259711		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	30259711	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	37328520	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

SUSD2 (sushi domain containing 2)