PROC (protein C, inactivator of coagulation factors Va and VIIIa)

Gene

• Entrez ID: 5624
• Gene name: Protein C, inactivator of coagulation factors Va and VIIIa
• Gene symbol: PROC
• Synonyms (NCBI Gene): APC, PC, PROC1, THPH3, THPH4
• Chromosome: 2
• Chromosome location: 2q14.3
• Summary: This gene encodes a vitamin K-dependent plasma glycoprotein. The encoded protein is cleaved to its activated form by the thrombin-thrombomodulin complex. This activated form contains a serine protease domain and functions in degradation of the activated f

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs121918148	A>C	Pathogenic	Coding sequence variant, missense variant
rs121918149	G>A	Pathogenic	Coding sequence variant, missense variant
rs369504169	G>A	Likely-pathogenic	Coding sequence variant, missense variant
rs754243426	G>A	Likely-pathogenic	Splice acceptor variant, intron variant, coding sequence variant, missense variant
rs757583846	C>T	Pathogenic, likely-pathogenic	Missense variant, coding sequence variant
rs1448630830	G>A,T	Likely-pathogenic	Coding sequence variant, missense variant, stop gained
rs1553423061	GTTATGG>-	Likely-pathogenic	Upstream transcript variant, frameshift variant, 5 prime UTR variant, genic upstream transcript variant, coding sequence variant
rs1553423955	G>A	Likely-pathogenic	Splice acceptor variant
rs1573442055	A>G	Likely-pathogenic	Splice acceptor variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1265030	hsa-miR-3682-5p	CLIP-seq
MIRT1265031	hsa-miR-3907	CLIP-seq
MIRT1265032	hsa-miR-4797-3p	CLIP-seq
MIRT1265033	hsa-miR-552	CLIP-seq
MIRT1265034	hsa-miR-764	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
ONECUT1	Activation	9553065

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004175	Function	Endopeptidase activity	IEA
GO:0004252	Function	Serine-type endopeptidase activity	IBA
GO:0004252	Function	Serine-type endopeptidase activity	IEA
GO:0004252	Function	Serine-type endopeptidase activity	IMP	25748729
GO:0004252	Function	Serine-type endopeptidase activity	TAS	15005336
GO:0005509	Function	Calcium ion binding	IEA
GO:0005515	Function	Protein binding	IPI	15248212, 32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	NAS	14718574
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	TAS	14718574
GO:0005783	Component	Endoplasmic reticulum	IDA	25748729
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005788	Component	Endoplasmic reticulum lumen	IEA
GO:0005788	Component	Endoplasmic reticulum lumen	TAS
GO:0005794	Component	Golgi apparatus	IDA	25748729
GO:0005794	Component	Golgi apparatus	IEA
GO:0005796	Component	Golgi lumen	IEA
GO:0005796	Component	Golgi lumen	TAS
GO:0006508	Process	Proteolysis	IBA
GO:0006508	Process	Proteolysis	IEA
GO:0006508	Process	Proteolysis	NAS	12052963
GO:0007596	Process	Blood coagulation	IBA
GO:0007596	Process	Blood coagulation	IEA
GO:0007599	Process	Hemostasis	IEA
GO:0008233	Function	Peptidase activity	IEA
GO:0008236	Function	Serine-type peptidase activity	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0030195	Process	Negative regulation of blood coagulation	TAS	15005336
GO:0043066	Process	Negative regulation of apoptotic process	IMP	12563316
GO:0050728	Process	Negative regulation of inflammatory response	IMP	25651845
GO:0050819	Process	Negative regulation of coagulation	IEA
GO:0050819	Process	Negative regulation of coagulation	IMP	25651845
GO:1903142	Process	Positive regulation of establishment of endothelial barrier	IMP	25651845

Other IDs

• MIM: 612283
• HGNC: 9451
• e!Ensembl: ENSG00000115718

Protein

• UniProt ID: P04070
• Protein name: Vitamin K-dependent protein C (EC 3.4.21.69) (Anticoagulant protein C) (Autoprothrombin IIA) (Blood coagulation factor XIV) [Cleaved into: Vitamin K-dependent protein C light chain; Vitamin K-dependent protein C heavy chain; Activation peptide]
• Protein function: Protein C is a vitamin K-dependent serine protease that regulates blood coagulation by inactivating factors Va and VIIIa in the presence of calcium ions and phospholipids (PubMed:25618265). Exerts a protective effect on the endothelial cell barr
• PDB: 1AUT, 1LQV, 3F6U, 3JTC, 4DT7, 6M3B, 6M3C, 8JRU, 8JRV, 9BVM
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00594	Gla	47 → 87	Vitamin K-dependent carboxylation/gamma-carboxyglutamic (GLA) domain	Domain
  PF00008	EGF	96 → 130	EGF-like domain	Domain
  PF14670	FXa_inhibition	140 → 175		Domain
  PF00089	Trypsin	212 → 445	Trypsin	Domain

• Tissue specificity: TISSUE SPECIFICITY: Plasma; synthesized in the liver.
• Sequence:

  MWQLTSLLLFVATWGISGTPAPLDSVFSSSERAHQVLRIRKRANSFLEELRHSSLERECI
  EEICDFEEAKEIFQNVDDTLAFWSKHVDGDQCLVLPLEHPCASLCCGHGTCIDGIGSFSC
  DCRSGWEGRFCQREVSFLNCSLDNGGCTHYCLEEVGWRRCSCAPGYKLGDDLLQCHPAVK
  FPCGRPWKRMEKKRSHLKRDTEDQEDQVDPRLIDGKMTRRGDSPWQVVLLDSKKKLACGA
  VLIHPSWVLTAAHCMDESKKLLVRLGEYDLRRWEKWELDLDIKEVFVHPNYSKSTTDNDI
  ALLHLAQPATLSQTIVPICLPDSGLAERELNQAGQETLVTGWGYHSSREKEAKRNRTFVL
  NFIKIPVVPHNECSEVMSNMVSENMLCAGILGDRQDACEGDSGGPMVASFHGTWFLVGLV
  SWGEGCGLLHNYGVYTKVSRYLDWIHGHIRDKEAPQKSWAP

• Sequence length: 461

Pathways

KEGG:

Complement and coagulation cascades

Reactome:

Intrinsic Pathway of Fibrin Clot Formation
Common Pathway of Fibrin Clot Formation
Gamma-carboxylation of protein precursors
Transport of gamma-carboxylated protein precursors from the endoplasmic reticulum to the Golgi apparatus
Removal of aminoterminal propeptides from gamma-carboxylated proteins
Cell surface interactions at the vascular wall
Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs)
Post-translational protein phosphorylation

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Abnormal thrombosis	Likely pathogenic; Pathogenic	rs121918149	RCV000852081	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Cerebral palsy	Likely pathogenic; Pathogenic	rs121918149	RCV001794425	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Deep venous thrombosis	Likely pathogenic; Pathogenic	rs369504169, rs1553424043, rs1321566264, rs777486993	RCV000851677 RCV000851641 RCV000851918 RCV000852197	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Hereditary thrombophilia due to congenital protein C deficiency	Likely pathogenic; Pathogenic	rs121918146, rs757583846, rs2468379908	RCV003985071 RCV005429227 RCV003595846	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
PROC-related disorder	Likely pathogenic; Pathogenic	rs121918148, rs121918149, rs121918152, rs2468365970, rs766261022, rs1189377845	RCV003398403 RCV004754229 RCV004754231 RCV003412530 RCV004754536 RCV004731041	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Reduced protein C activity	Likely pathogenic; Pathogenic	rs121918143, rs121918153, rs1458669732, rs568121876, rs2104954946, rs142742242, rs766261022, rs754243426, rs1573444020, rs1247269491, rs1254257945, rs201907715, rs769277939, rs1573461792, rs1573461951, rs1573462001, rs1186036467, rs758576042	RCV000851836 RCV000852185 RCV002245353 RCV002245354 RCV002245356 RCV000851669 RCV002245610 RCV000851876 RCV000852122 RCV000851793 RCV000852153 RCV000851922 RCV000851961 RCV000852001 RCV000851681 RCV000851689 RCV000851692 RCV000851888 RCV002245902	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Thromboembolism	Likely pathogenic; Pathogenic	rs121918154, rs369504169, rs1553424043, rs1573442055	RCV000852227 RCV000851677 RCV000851641 RCV000851746	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Thrombophilia due to protein C deficiency, autosomal dominant	Pathogenic; Likely pathogenic	rs2104953327, rs1450037999, rs199469476, rs140582220, rs1257816310, rs1434042239, rs1558715877, rs1688706297, rs1277271891, rs370813536, rs1688677671, rs199469470, rs772629538, rs780456728, rs757925208, rs121918141, rs121918142, rs121918143, rs121918145, rs121918146, rs121918152, rs121918153, rs1688706133, rs121918154, rs1558715857, rs121918155, rs121918158, rs2104934553, rs121918159, rs121918160, rs2104954798, rs764546127, rs2468340110, rs369504169, rs142742242, rs757583846, rs897196091, rs2468367271, rs2468376955, rs2468366132, rs2468324848, rs2468377531, rs2468337332, rs1247902323, rs2468318751, rs199469478, rs1333329860, rs1553424043, rs374476971, rs1553423955, rs767112991, rs1558718572, rs766261022, rs1321566264, rs1448630830, rs1305782685, rs1247269491, rs777486993, rs201907715, rs769277939, rs199469471, rs1189377845, rs1688218776, rs1456533664, rs774572099, rs758576042, rs1688667609	RCV001353252 RCV001353253 RCV001353251 RCV001378884 RCV001387152 RCV001387153 RCV001380376 RCV001731126 RCV001801306 RCV001801313 RCV001801320 RCV001927369 RCV001898011 RCV001946007 RCV001914156 RCV000000690 RCV000000691 RCV000000693 RCV000778563 RCV000689442 RCV000000703 RCV000000704 RCV000000705 RCV000000706 RCV000000707 RCV000000709 RCV000000712 RCV000000713 RCV000000714 RCV000000715 RCV002221179 RCV005626610 RCV002280946 RCV000148739 RCV000148740 RCV000168170 RCV002651509 RCV002664254 RCV002664255 RCV002731553 RCV002776556 RCV003484567 RCV003484571 RCV003484573 RCV003496095 RCV003494639 RCV000468802 RCV000541810 RCV000625577 RCV000645702 RCV000645701 RCV000702225 RCV000702555 RCV000689154 RCV000761310 RCV000761311 RCV002281128 RCV005092222 RCV001869073 RCV002221155 RCV000821496 RCV000818570 RCV001039540 RCV001040855 RCV001379312 RCV001248247 RCV001248804	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Thrombophilia due to protein C deficiency, autosomal recessive	Pathogenic; Likely pathogenic	rs1434042239, rs199469470, rs780456728, rs121918143, rs121918144, rs121918145, rs121918146, rs121918147, rs121918148, rs121918149, rs121918151, rs121918152, rs121918153, rs121918157, rs757583846, rs767112991, rs769277939, rs199469471, rs1456533664, rs774572099	RCV002488208 RCV002503517 RCV004796685 RCV000000694 RCV000000695 RCV000000696 RCV000000697 RCV000000698 RCV000000699 RCV000000700 RCV000000702 RCV006257255 RCV002504732 RCV000000711 RCV002498834 RCV002507104 RCV000984956 RCV002487843 RCV004031230 RCV002497682	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ANTIPHOSPHOLIPID SYNDROME	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ARTERITIS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BLOOD COAGULATION DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CENTRAL RETINAL VEIN OCCLUSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CEREBRAL INFARCTION	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL THROMBOTIC DISEASE, DUE TO PROTEIN C DEFICIENCY	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEEP VEIN THROMBOSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DISSEMINATED INTRAVASCULAR COAGULATION	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hereditary angioedema with normal C1Inh	not provided	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSIVE DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY FAILURE, ACUTE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEPSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
THROMBOPHILIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thrombophilia 3 due to protein C deficiency	Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
THROMBOPHILIA DUE TO ACTIVATED PROTEIN C RESISTANCE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
THROMBOPHILIA, HEREDITARY, DUE TO PROTEIN C DEFICIENCY, AUTOSOMAL DOMINANT	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
THROMBOSIS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TOXIC SHOCK SYNDROME	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VENOUS THROMBOEMBOLISM	—	CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VENOUS THROMBOSIS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Abnormal dermatoglyphic pattern	Abnormal dermatoglyphic pattern	HPO_DG			★☆☆☆☆ Found in Text Mining only
Activated Protein C Resistance	Activated Protein C Resistance	BEFREE	10070830, 10195932, 10368524, 10678272, 10779003, 10845571, 10871461, 11165549, 11204592, 11246546, 12091344, 12152677, 12353074, 12742330, 12752078, 12783110, 14976057, 15257017, 15257714, 15706475, 15706477, 16138341, 16359508, 16601829, 16934314, 18768782, 19535131, 19947358, 20002000, 20002539, 20214832, 20736749, 23188048, 24523236, 24818532, 25407022, 25656775, 25771983, 27090446, 27161771, 28196919, 28804824, 29063359, 29162399, 7485105, 7590506, 7631299, 7631684, 7665978, 7740584, 7780127, 7865690, 7911873, 7989612, 8108421, 8164741, 8180338, 8547095, 8578447, 8578503, 8589213, 8603019, 8639839, 8652396, 8671856, 8701395, 8701401, 8733870, 8815565, 8815575, 8837307, 8845465, 8868517, 8899255, 8913958, 8952864, 8956934, 8970058, 9065990, 9083758, 9128263, 9134384, 9136971, 9157592, 9170375, 9210909, 9219326, 9241708, 9299854, 9304527, 9454742, 9486021, 9499670, 9531040, 9763348, 9763350, 9842043		★☆☆☆☆ Found in Text Mining only
Activated Protein C Resistance	Activated Protein C Resistance	LHGDN	14976057, 18768782		★☆☆☆☆ Found in Text Mining only
Acute pancreatitis	Pancreatitis	BEFREE	19680809		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	10212817, 10674823, 11048797, 11062151, 11078757, 11304579, 11315765, 11338478, 12163385, 12455028, 12584167, 12841866, 12907646, 12966349, 1338691, 15197775, 15639718, 16278815, 16619216, 16736496, 16991125, 17293392, 17964080, 19259700, 19576232, 20179237, 20210251, 20978327, 21538028, 22158121, 22262720, 22542170, 24470207, 25344691, 25496852, 25602793, 26862903, 27984236, 28059096, 29156563, 29525853, 31406299, 7958689, 8019564, 8081386, 8440743, 8552404, 8616831, 8649856, 8903471, 8943812, 9033644, 9155671		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	12907646, 16407829, 16619216, 17964080		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	CTD_human_DG	15639718, 9111214		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of colon	Adenocarcinoma Of Colon	BEFREE	9589476		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of colon	Adenocarcinoma Of Colon	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of duodenum	Adenocarcinoma Of Duodenum	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of duodenum	Adenocarcinoma Of Duodenum	HPO_DG			★☆☆☆☆ Found in Text Mining only
Adenocarcinoma Of Esophagus	Esophageal Cancer	BEFREE	11078757, 19149902		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of large intestine	Colorectal Cancer	GWASCAT_DG	30510241		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of large intestine	Colorectal Cancer	BEFREE	7585508		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of large intestine	Colorectal Cancer	CGI_DG			★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	CLINVAR_DG	18948947, 25157968		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	29378962		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	CGI_DG			★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	8950667		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of rectum	Adenocarcinoma Of Rectum	BEFREE	10674823, 19304403		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Basal Cell	Adenocarcinoma	CTD_human_DG	15639718, 9111214		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Oxyphilic	Adenocarcinoma	CTD_human_DG	15639718, 9111214		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Tubular	Adenocarcinoma	CTD_human_DG	15639718, 9111214		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	10201489, 10440612, 10489374, 10602369, 10638959, 10668214, 10681434, 10818595, 10969779, 10976694, 11062151, 11092973, 11241408, 11309300, 11450991, 11474297, 11487553, 11522744, 11819789, 11839557, 11867715, 11987262, 12163385, 12502211, 12522539, 12524418, 12530096, 12606733, 12673484, 12737446, 12782759, 12920223, 1338760, 1338904, 14578138, 1528264, 15386431, 15657662, 15932553, 16152625, 16545110, 16804962, 16804979, 16941501, 16998667, 17039270, 17047023, 17064931, 17085661, 17106246, 17680350, 18612690, 18782851, 19123982, 19576232, 1977514, 19912361, 20196079, 20687945, 21287799, 21412070, 22266195, 22308460, 22848674, 22851115, 23408899, 23764768, 24416237, 24801760, 25263173, 25432628, 25496852, 26169059, 26202952, 27221540, 27783336, 27816598, 27984236, 28179590, 28243320, 28548127, 29148535, 29212857, 29438366, 29525853, 30166531, 7478622, 7515658, 7606737, 7674088, 7743497, 7753564, 7979155, 8081386, 8111410, 8118796, 8187091, 8242739, 8809879, 8895682, 8903471, 9083931, 9096643, 9490271, 9566701, 9600124, 9724771, 9739783, 9744312, 9828834, 9973276		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	CTD_human_DG	10383901, 12034317, 19092804, 30188895, 9111214		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	LHGDN	12163385, 12737446, 16804979, 17569124, 17964080, 18199528, 18403596		★☆☆☆☆ Found in Text Mining only
Adenoma of large intestine	Colorectal adenoma	BEFREE	10213492, 10391560, 10470088, 10602369, 10681434, 11001924, 11241408, 12374230, 12527714, 12537656, 12606733, 12673484, 12894559, 14579148, 14999774, 15034862, 15172124, 15266213, 15376262, 15386431, 15623940, 15788729, 16804979, 16843107, 17505512, 17638869, 17949294, 18091433, 18199528, 18632657, 19474113, 19531215, 19578404, 19701947, 20510605, 20643622, 21287799, 22851115, 23846443, 23919615, 23998936, 26613750, 26863316, 26880076, 28515349, 29215473, 29951927, 31383941, 7559732, 7962323, 8012980, 8080037, 8862382, 8865849, 9000553, 9024698, 9724771, 9828834		★☆☆☆☆ Found in Text Mining only
Adenoma of large intestine	Colorectal adenoma	GWASCAT_DG	30510241		★☆☆☆☆ Found in Text Mining only
Adenoma, Basal Cell	Adenoma	CTD_human_DG	10383901, 12034317, 19092804, 30188895, 9111214		★☆☆☆☆ Found in Text Mining only
Adenoma, Basal Cell	Adenoma	BEFREE	29496310		★☆☆☆☆ Found in Text Mining only
Adenoma, Microcystic	Adenoma	CTD_human_DG	10383901, 12034317, 19092804, 30188895, 9111214		★☆☆☆☆ Found in Text Mining only
Adenoma, Monomorphic	Adenoma	CTD_human_DG	10383901, 12034317, 19092804, 30188895, 9111214		★☆☆☆☆ Found in Text Mining only
Adenoma, Trabecular	Adenoma	CTD_human_DG	10383901, 12034317, 19092804, 30188895, 9111214		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	10051640, 10077047, 10083733, 10090483, 10094547, 10094557, 10205208, 10213492, 10223748, 10226605, 10228493, 10347554, 10363573, 10367940, 10398435, 10440612, 10470088, 10482959, 10494086, 10545404, 10545697, 10545699, 10562580, 10597266, 10634400, 10646887, 10651483, 10665844, 10681434, 10713886, 10737795, 10746979, 10749615, 10754205, 10768871, 10782927, 10784639, 10812168, 10830991, 10854222, 10868458, 10923044, 10956391, 10969779, 10980114, 11001924, 11092973, 11099951, 11106555, 11145293, 11196455, 11205230, 11238048, 11241320, 11247895, 11247896, 11257105, 11263856, 11409872, 11429699, 11450991, 11466687, 11485029, 11506490, 11516998, 11522744, 11553046, 11593435, 11605029, 11668620, 11693343, 11696422, 11713587, 11748858, 11754114, 11756777, 11808944, 11823972, 11839722, 11852337, 11857735, 11867715, 11868006, 11896079, 11933206, 11956815, 11956818, 11978510, 12007223, 12112318, 12117880, 12136240, 12172928, 12173026, 12174906, 12357334, 12445067, 12474227, 12522539, 12524552, 12530096, 12581900, 12595050, 12606733, 12628248, 12647217, 12701683, 12721244, 12740057, 12740349, 12774245, 12833148, 12894596, 12901799, 12920223, 1310068, 1315124, 1316610, 1319838, 1324223, 1324739, 1325301, 1325652, 1327364, 1338760, 1338764, 1338904, 1350108, 1350438, 1351034, 1355210, 14502807, 14523376, 14574009, 14654913, 14691304, 14724163, 14735163, 14749686, 14961559, 14966376, 14986031, 15043293, 15075785, 15087381, 15089902, 15107603, 15108286, 15108288, 1511028, 1511369, 15131404, 15264268, 15287021, 15314168, 15361208, 15366000, 15368361, 15459959, 15466175, 15475941, 15540296, 15542524, 15557107, 15623481, 15641992, 15643602, 1565631, 15660526, 15684875, 15719192, 15727247, 15761860, 15771908, 15788729, 15793634, 15857185, 15951963, 16088911, 16106429, 16126064, 16134147, 16150893, 16152625, 16158975, 16253019, 16287072, 16292097, 16317745, 16411234, 1643645, 16454848, 16455870, 1646139, 16478792, 16510566, 1651563, 16557584, 16596323, 16629258, 16650078, 16680592, 16736293, 16804979, 16820884, 16858687, 16912203, 16941501, 16982769, 16998667, 16998668, 16998673, 17052257, 17064931, 17122612, 17135276, 17221838, 17238184, 17251345, 17355417, 17360132, 17410559, 17486639, 17568392, 17570218, 17572842, 17604324, 17620292, 17696956, 17882487, 17909068, 17916546, 17952864, 17954272, 17963004, 18026870, 18027849, 18075263, 18160396, 18166348, 18224684, 18294051, 18369740, 18391979, 18406876, 18418860, 18422726, 18425378, 18433509, 18487285, 18498268, 18612690, 18629513, 18662704, 18704758, 18794146, 18854359, 18977219, 18982352, 19029688, 19036155, 19111562, 19149902, 19196998, 19331226, 19392654, 19414146, 19414147, 19444466, 19474113, 19531215, 19573802, 19578404, 19593690, 19617769, 19684041, 19728755, 19766128, 19768578, 1977514, 19779968, 1978564, 19793053, 19847890, 19900189, 19912361, 19931546, 19966865, 20141232, 20176656, 20196079, 20210251, 20229069, 20333795, 20352275, 20434453, 20446826, 20510605, 20513532, 20564245, 20569184, 20618354, 20649969, 20685668, 20924072, 20935450, 20978149, 21110124, 21134075, 21195604, 21315632, 21411865, 21484796, 21518821, 21598003, 21643010, 21649465, 21665989, 2172153, 21769429, 21860414, 21901790, 21904137, 21931686, 22080605, 22150579, 22180177, 22305464, 22308460, 22372443, 22395475, 22431159, 22447671, 22692730, 22741528, 22799487, 22825485, 22847197, 22864254, 22886683, 22961697, 22987206, 23011394, 23159591, 23291410, 23334997, 23604857, 23708654, 23725351, 23771323, 23838596, 23873622, 23906606, 24169521, 24197976, 24253443, 24378386, 24403225, 24599579, 24643704, 24664542, 24702198, 24735542, 24763434, 24824929, 24946964, 25127143, 25159889, 25183641, 25208568, 25243319, 25604157, 2571580, 25716913, 25751801, 25820106, 25832318, 26161710, 26163615, 26179480, 26186212, 26252958, 26309368, 26311738, 26446593, 26447891, 26613750, 26625971, 26663236, 26797314, 26880076, 27000756, 27087319, 27158207, 27217144, 27291484, 27391059, 27511199, 27623068, 27648962, 27679509, 27705013, 28010732, 28057861, 28063132, 28105931, 28134256, 28306719, 28414304, 28418912, 28423518, 28533537, 28551651, 28576136, 28628110, 28659575, 28663347, 28668823, 28791770, 28792655, 28866416, 28955048, 28986688, 29251405, 29309780, 29367705, 29368261, 29368299, 29696324, 29719120, 29901124, 30012100, 30024920, 30256815, 30259713, 30269086, 30324682, 30333551, 30340471, 30569724, 30640173, 30724425, 30836352, 30852976, 30880117, 30904095, 30919136, 30983515, 31062380, 31113927, 31201235, 31269945, 31337618, 31383941, 31441682, 31471457, 31591141, 31712236, 31739127, 7485167, 7515658, 7524601, 7557972, 7562975, 7577053, 7577080, 7585543, 7641184, 7661930, 7669739, 7675542, 7753564, 7795585, 7796392, 7797123, 7798298, 7840521, 7864589, 7866403, 7882361, 7903889, 7913010, 7915330, 7927873, 7959691, 7962323, 7981058, 8012355, 8020934, 8061582, 8094265, 8111410, 8125478, 8162022, 8187091, 8194700, 8213830, 8221638, 8242071, 8247073, 8252630, 8252631, 8256823, 8257086, 8381579, 8381580, 8381581, 8385047, 8388766, 8388848, 8389242, 8395941, 8402712, 8471756, 8521721, 8522331, 8537055, 8544194, 8561861, 8616874, 8655134, 8730279, 8730280, 8741802, 8764128, 8835324, 8862382, 8882539, 8888441, 8903471, 8931709, 8941012, 8968744, 8990002, 9000553, 9010867, 9012454, 9038672, 9041484, 9062090, 9062584, 9147878, 9156320, 9176082, 9182290, 9182775, 9202668, 9207294, 9250146, 9288102, 9298819, 9327228, 9341879, 9375853, 9382065, 9391252, 9438104, 9445111, 9458096, 9494520, 9496836, 9506763, 9512122, 9521420, 9585611, 9595262, 9600336, 9601641, 9663391, 9669663, 9705533, 9724771, 9731533, 9744495, 9751605, 9806823, 9809998, 9824350, 9824584, 9841749, 9865843, 9916927, 9950360, 9973276		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	CLINVAR_DG	10077047, 10083733, 10094547, 10213492, 10713886, 10768871, 11247895, 11247896, 12007223, 12172928, 12173026, 12357334, 12408524, 12494469, 1316610, 1324223, 14523376, 14729851, 15024739, 15095859, 15108286, 15300576, 15300853, 15459959, 15857185, 15951963, 16088911, 16134147, 16292097, 16461775, 17026565, 17411426, 17604324, 17785554, 17963004, 18063416, 18433509, 19029688, 19331226, 19444466, 19793053, 20223039, 20434453, 20564245, 20649969, 20685668, 20924072, 21110124, 21476993, 21643010, 21779980, 21970370, 23159591, 25159915, 25525159, 25604157, 25980754, 26138249, 26681312, 28349240, 7906810, 8118461, 8187091, 8252630, 8381579, 8625067, 8990002, 9101302, 9298819, 9342373, 9585611, 9664575, 9824584		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	UNIPROT_DG	10470088, 1338691, 1338764, 1338904, 1651563, 21643010, 27217144, 7661930, 7833149, 7833931, 8990002		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	CTD_human_DG	11040535, 11420398, 11588890, 11766074, 12394442, 17942926, 18704758, 25200834, 25280562, 28414304, 8071957		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	LHGDN	11668620, 11754114, 11809682, 11868006, 11933206, 11972058, 12136240, 12173026, 12581900, 12606575, 12647217, 12901799, 14574158, 14662741, 14691304, 14729851, 14961559, 15020226, 15327769, 15459959, 15689459, 15821699, 15833136, 15943410, 16088911, 16322291, 16433700, 16461775, 16680592, 16820884, 17410430, 17486639, 17489848, 17854661, 17882487, 17905526, 17952864, 17954272, 17963004, 17968317, 18026870, 18063416, 18321998, 18406876, 18844223, 18987576, 19036155, 19061640		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	GENOMICS_ENGLAND_DG	23788249, 26697262		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyps	Adenomatous Polyposis	BEFREE	10545697, 10630180, 10938175, 11317365, 11354631, 12833148, 1317264, 14502807, 14578138, 15150130, 15236166, 16510566, 18406876, 18632657, 30383609, 31111538, 8940264, 9182775		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyps	Adenomatous Polyposis	CTD_human_DG	12810952		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyps	Adenomatous Polyposis	LHGDN	18632657		★☆☆☆☆ Found in Text Mining only
Adrenal Cortical Adenoma	Adrenocortical adenoma	BEFREE	19684041		★☆☆☆☆ Found in Text Mining only
Adrenal Cortical Adenoma	Adrenocortical adenoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	BEFREE	15796198		★☆☆☆☆ Found in Text Mining only
Adrenocortical carcinoma	Adrenocortical carcinoma	BEFREE	1351034		★☆☆☆☆ Found in Text Mining only
Adrenocortical Carcinoma	Adrenocortical carcinoma	Pubtator	25078331, 29872083, 33564960	Associate	★☆☆☆☆ Found in Text Mining only
Adrenocortical carcinoma	Adrenocortical carcinoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	10375116, 12555076, 15077159, 17238184, 23525311, 30523493, 31504825, 9215849		★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	CTD_human_DG	7661930		★☆☆☆☆ Found in Text Mining only
Adult Oligodendroglioma	Oligodendroglioma	BEFREE	7515658		★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	15541474		★☆☆☆☆ Found in Text Mining only
Afibrinogenemia	Afibrinogenemia	BEFREE	8357104		★☆☆☆☆ Found in Text Mining only
African Burkitt`s lymphoma	African Burkitt`s Lymphoma	CTD_human_DG	23143597		★☆☆☆☆ Found in Text Mining only
Agenesis of corpus callosum	Agenesis Of Corpus Callosum	BEFREE	11891193, 21088256, 24590585		★☆☆☆☆ Found in Text Mining only
Alpha thalassemia intermedia	alpha Thalassemia	BEFREE	30384036		★☆☆☆☆ Found in Text Mining only
Alternating esotropia	Alternating esotropia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Alveolar Soft Part Sarcoma	Alveolar Sarcoma	BEFREE	10834386		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	25410733, 26417591, 31026621, 33797837, 34440432	Associate	★☆☆☆☆ Found in Text Mining only
Ameloblastoma	Ameloblastoma	BEFREE	18486530		★☆☆☆☆ Found in Text Mining only
AMYLOIDOSIS, HEREDITARY, TRANSTHYRETIN-RELATED	Amyloidosis	BEFREE	10646887, 11257105, 12901799, 14691304, 14961559, 15131404, 15643602, 15660526, 15684875, 15761860, 16998668, 16998673, 17135276, 18369740, 18629513, 19392654, 19768578, 20196079, 20229069, 20649969, 20935450, 21110124, 21411865, 22987206, 25159889, 25716913, 26446593, 30259713, 30340471, 8968744, 9375853, 9950360		★☆☆☆☆ Found in Text Mining only
Anal carcinoma	Anal Cancer	BEFREE	11598481		★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	25862857		★☆☆☆☆ Found in Text Mining only
Androgen-Insensitivity Syndrome	Androgen-Insensitivity Syndrome	BEFREE	30980692		★☆☆☆☆ Found in Text Mining only
Anemia Sickle Cell	Sickle cell anemia	Pubtator	11972526, 22052675, 9332318	Associate	★☆☆☆☆ Found in Text Mining only
Anemia, Macrocytic	Anemia	CTD_human_DG	27725143		★☆☆☆☆ Found in Text Mining only
Aneuploidy	Aneuploidy	Pubtator	15623940, 16763565, 20368985, 21190457, 28576136	Associate	★☆☆☆☆ Found in Text Mining only
Aneurysm	Aneurysm	Pubtator	35627118	Associate	★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	29303701		★☆☆☆☆ Found in Text Mining only
Anodontia	Anodontia	Pubtator	31243121, 32466784	Associate	★☆☆☆☆ Found in Text Mining only
Antiphospholipid Syndrome	Antiphospholipid Syndrome	BEFREE	22290026		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Antiphospholipid Syndrome	Antiphospholipid syndrome	Pubtator	25196808, 36012233	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Antiphospholipid Syndrome	Antiphospholipid syndrome	Pubtator	7814631	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Antithrombin III Deficiency	Antithrombin deficiency	Pubtator	11292195	Inhibit	★☆☆☆☆ Found in Text Mining only
Antithrombin III Deficiency	Antithrombin Deficiency	BEFREE	11821094, 15713144, 22398278, 28861852, 7742536, 8701395		★☆☆☆☆ Found in Text Mining only
Antithrombin III Deficiency	Antithrombin deficiency	Pubtator	22443383, 30637129, 30975910	Associate	★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	10223748, 28749453		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	10223748, 28749453		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	LHGDN	18184931		★☆☆☆☆ Found in Text Mining only
APC-related attenuated familial adenomatous polyposis	Adenomatous Polyposis	Orphanet			★☆☆☆☆ Found in Text Mining only
Aplasia Cutis Congenita	Aplasia Cutis Congenita	BEFREE	11891193, 21088256, 24590585		★☆☆☆☆ Found in Text Mining only
Aplastic Anemia	Aplastic anemia	BEFREE	28968996		★☆☆☆☆ Found in Text Mining only
Apnea	Apnea	Pubtator	31884442	Associate	★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	23212804, 25032959, 29216392, 9950657		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	30649471		★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	17491095	Associate	★☆☆☆☆ Found in Text Mining only
Asphyxia Neonatorum	Postnatal asphyxia	BEFREE	30225791		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	14604971		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	GWASDB_DG	21907864		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Astrocytoma	Astrocytoma	Pubtator	15367334, 29741737, 36662405	Associate	★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	23212804, 25032959, 29216392, 9950657		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	25376901	Associate	★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	30988731		★☆☆☆☆ Found in Text Mining only
Attention Deficit and Disruptive Behavior Disorders	Attention deficit hyperactivity disorder	Pubtator	25410733	Associate	★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	29912347, 31834588		★☆☆☆☆ Found in Text Mining only
Attenuated familial adenomatous polyposis	Adenomatous polyposis	Pubtator	14691304, 14724162, 16253019, 16461775, 18063416, 18091433, 18176357, 19531215, 20033212, 20434453, 22180177, 22851115, 23244118, 23561487, 24169521, 30012100, 31285513, 31712236, 33670833, 9585611, 9724771	Associate	★☆☆☆☆ Found in Text Mining only
Atypical Endometrial Hyperplasia	Endometrial Hyperplasia	BEFREE	17089036		★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	39756803	Associate	★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	17221838		★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	LHGDN	17221838		★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	CTD_human_DG	17221838, 8071957		★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	GWASDB_DG	22843504		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	29232721, 29303701		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	30675228, 30776747		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	BEFREE	11016622, 11078757, 11338478, 15197775, 16278815, 16407829, 18831746, 19048617, 23771323, 29440928, 30144514, 9155671		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	11232646, 19584833, 26068095, 9155671	Associate	★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	LHGDN	16407829		★☆☆☆☆ Found in Text Mining only
Basal Cell Nevus Syndrome	Basal Cell Neoplasm	BEFREE	10375116		★☆☆☆☆ Found in Text Mining only
Beckwith-Wiedemann Syndrome	Beckwith-Wiedemann Syndrome	BEFREE	29190888		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	21851971		★☆☆☆☆ Found in Text Mining only
Benign Neoplasm	Benign Neoplasm	BEFREE	1528264		★☆☆☆☆ Found in Text Mining only
Benign neoplasm of stomach	Benign Neoplasm Of Stomach	CGI_DG			★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	18242387		★☆☆☆☆ Found in Text Mining only
Benign tumor of pancreas	Benign Tumor Of Pancreas	CGI_DG			★☆☆☆☆ Found in Text Mining only
beta Thalassemia	Beta thalassemia	Pubtator	10606878	Associate	★☆☆☆☆ Found in Text Mining only
beta Thalassemia	Beta thalassemia	Pubtator	12111782	Inhibit	★☆☆☆☆ Found in Text Mining only
bilateral breast cancer	Breast Cancer	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Biliary Tract Neoplasms	Biliary tract neoplasms	Pubtator	36243179	Associate	★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	GWASCAT_DG	31043756		★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	CTD_human_DG	31043756		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	11956582, 18006010, 19522860, 21680534, 30568459, 30868894, 8632608, 9221807		★☆☆☆☆ Found in Text Mining only
Blepharoptosis	Ptosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders	Blood Coagulation Disorders	BEFREE	10195932, 10468797, 19141162, 19175419, 23443294, 27841821, 30015643, 30086072, 30260475, 30916034, 7740584, 8867589		★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders	Blood coagulation disorder	Pubtator	11456407, 11697723, 15710622, 19552680, 21818732, 23188048, 24349325, 25119470, 25564403, 25651845, 25891444, 36560757, 36991043, 37733304, 39846164, 8353282, 9007985	Associate	★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders	Blood coagulation disorder	Pubtator	11972526	Inhibit	★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders	Blood coagulation disorder	Pubtator	36991043	Stimulate	★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders Inherited	Blood coagulation disorder	Pubtator	33864376	Associate	★☆☆☆☆ Found in Text Mining only
Blood Platelet Disorders	Platelet disorder	Pubtator	10339485	Associate	★☆☆☆☆ Found in Text Mining only
Bohring syndrome	Bohring syndrome	Pubtator	37289003	Associate	★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Brain ischemia	Pubtator	11391722	Associate	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	LHGDN	14729851		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	17238184, 7515658, 7661930, 9215849, 9589476		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	24968695, 7661930	Associate	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	HPO_DG			★☆☆☆☆ Found in Text Mining only
Brain Tumor, Primary	Brain Neoplasms	BEFREE	10337989, 17389002		★☆☆☆☆ Found in Text Mining only
BRAIN TUMOR-POLYPOSIS SYNDROME 2 (disorder)	Brain-Tumor-Polyposis syndrome	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Breast Cancer, Familial	Breast Cancer	BEFREE	27983523		★☆☆☆☆ Found in Text Mining only
Breast cancer, lobular	Breast Cancer	BEFREE	12800196		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	10555757, 10660330, 11179484, 11880707, 15251938, 15508191, 15671542, 16273236, 16924228, 17065059, 17301249, 18283316, 18398311, 18708403, 18841156, 19829046, 19891966, 19921426, 20226036, 20490964, 21901790, 22026417, 22037257, 22359284, 23219837, 23869875, 25684670, 26070193, 26407953, 26945992, 27191268, 27890529, 27936456, 27983523, 28349825, 29024812, 29297603, 30005601, 30720232, 7798298, 8061582, 8318422, 9679946, 9690990		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Breast Diseases	Breast Diseases	BEFREE	15508191		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	10555757, 10854222, 10901363, 11437404, 12492586, 17998253, 18485221, 18593979, 18708403, 18841156, 19789364, 19829046, 19921426, 20226036, 20490964, 20682973, 20696638, 21279955, 21383541, 22026417, 22037257, 22986510, 23827720, 24205493, 25407022, 25684670, 26070193, 26407953, 26452468, 26945992, 27218469, 27281609, 27890529, 27936456, 27983523, 28349825, 28403857, 29024812, 31704974, 31874204, 33277842, 33461604, 34327780, 34715905, 34857895, 34866136, 35799892, 36499743, 36499753, 39684297, 7798298	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	39742384	Stimulate	★☆☆☆☆ Found in Text Mining only
Bronchial Hyperreactivity	Bronchial Hyperreactivity	BEFREE	14604971		★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	27957795, 8275728		★☆☆☆☆ Found in Text Mining only
Budd-Chiari Syndrome	Budd-Chiari syndrome	BEFREE	10378363		★☆☆☆☆ Found in Text Mining only
Burkitt Leukemia	Burkitt`s Lymphoma	CTD_human_DG	23143597		★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	CTD_human_DG	23143597		★☆☆☆☆ Found in Text Mining only
Byzanthine arch palate	High palate	HPO_DG			★☆☆☆☆ Found in Text Mining only
CADASIL Syndrome	CADASIL Syndrome	BEFREE	30883460		★☆☆☆☆ Found in Text Mining only
Calcinosis	Calcinosis	Pubtator	37427430	Associate	★☆☆☆☆ Found in Text Mining only
Cancer of Nasopharynx	Nasopharyngeal Cancer	BEFREE	28543390		★☆☆☆☆ Found in Text Mining only
Cancer Other	Cancer	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	10638959, 10817505, 11920497, 12057910, 12378616, 12378619, 12387883, 16461775, 16763565, 17176113, 17704816, 17786187, 18444242, 19661324, 20345486, 21057000, 21403838, 23244118, 23251453, 23661344, 24949429, 26311738, 26991699, 27175599, 27254743, 28576136, 28645942, 29275959, 29575536, 30024920, 30186819, 30229897, 32102509, 32543103, 33060621, 33335067, 34003820, 34843512, 35605119, 35658010, 35697349, 39684297, 7947085, 7958689, 8080037, 8226275, 8799152, 9294210, 9823979	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	11279192	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	10213492, 10638959, 11067929, 11078757, 11092973, 11117578, 11215281, 11241408, 11448917, 11819821, 11920497, 11956582, 11956815, 12049310, 12378616, 12469186, 12584179, 12673484, 12782759, 1338904, 1355210, 14579148, 15040027, 15213719, 15266213, 1528264, 15476557, 16075282, 16804962, 18632876, 1977514, 19900189, 20025482, 21359685, 21892521, 22266195, 22886683, 23055343, 23846443, 23906606, 23998936, 25656989, 26232338, 26863316, 26970738, 27816598, 28059096, 29793804, 7585453, 7674088, 7743497, 7753564, 7927902, 7958689, 7962323, 8055154, 8111410, 8226275, 8809879, 9033644, 9369932, 9433138, 9576568, 9689649, 9739783		★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Carcinoma Adenoid Cystic	Adenoid cystic carcinoma	Pubtator	15195113	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	19448414, 30089731	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal Breast	Ductal carcinoma of breast	Pubtator	19789364	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	12937151, 14507645, 17900245, 17973119, 18161048, 18803358, 19818350, 20079733, 20165882, 22180715, 24564909, 26000761, 28418032, 28902288, 29865038, 31033235, 34250406, 37480572, 38019243	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma in situ of stomach	Stomach Carcinoma	CGI_DG			★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	25331261	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of ampulla of Vater	Ampullary Carcinoma	BEFREE	25975284		★☆☆☆☆ Found in Text Mining only
Carcinoma of ampulla of Vater	Ampullary Carcinoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	18006010, 19522860, 21680534, 30568459, 30868894, 8632608, 9221807		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	10528207, 10549031, 1348017, 15146565, 18844936, 18996677, 21229606, 22542170, 26350096, 26631510, 28497891, 28938637, 8943812		★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	24293293, 26394139, 32113160, 35205366	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	35231161	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	24715170, 7958689	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	24573469, 25395299		★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Carcinoma, Cribriform	Carcinoma	CTD_human_DG	15639718, 9111214		★☆☆☆☆ Found in Text Mining only
Carcinoma, Endometrioid	Endometrioid cancer	BEFREE	11048799		★☆☆☆☆ Found in Text Mining only
Carcinoma, Granular Cell	Carcinoma	CTD_human_DG	15639718, 9111214		★☆☆☆☆ Found in Text Mining only
Carcinoma, Neuroendocrine	Carcinoma	BEFREE	26434631		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	23055343, 24078348, 24761891, 29653924, 31737207, 31829231, 8019564, 9679945		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Alcoholic	Cardiomyopathy	BEFREE	31206165		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	18662704		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	17677000, 18680534, 29890521		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	35075098	Associate	★☆☆☆☆ Found in Text Mining only
Carotid Artery Diseases	Carotid artery disease	Pubtator	36142883	Associate	★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	BEFREE	9950657		★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	Pubtator	23781296	Stimulate	★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	HPO_DG			★☆☆☆☆ Found in Text Mining only
Cayler cardiofacial syndrome	Cayler cardiofacial syndrome	Pubtator	11819789	Associate	★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	BEFREE	20179237		★☆☆☆☆ Found in Text Mining only
Cenani-Lenz syndrome	Cenani-Lenz Syndrome	Orphanet			★☆☆☆☆ Found in Text Mining only
Central Nervous System Diseases	Central nervous system disease	Pubtator	9508117	Associate	★☆☆☆☆ Found in Text Mining only
Central Nervous System Neoplasms	Central Nervous System Neoplasms	BEFREE	17238184		★☆☆☆☆ Found in Text Mining only
Central Nervous System Neoplasms	Central nervous system neoplasm	Pubtator	38139220, 9508117	Associate	★☆☆☆☆ Found in Text Mining only
Central Nervous System Neoplasms	Central Nervous System Neoplasms	CGI_DG			★☆☆☆☆ Found in Text Mining only
Cerebellar medulloblastoma	Cerebellar medulloblastoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	15678277, 19691480, 30383853, 32568648, 33761690	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cerebral Infarction	Ischemic stroke	Pubtator	30450637	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cerebral Palsy	Cerebral palsy	Pubtator	20187890	Associate	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Cerebral Palsy	Cerebral palsy	HPO_DG			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Cerebrovascular accident	Stroke	BEFREE	10494665, 12563316, 15678277, 19166505, 19302148, 23670045, 26372516, 28452132, 29343482, 29866816, 29890521, 30225791, 31356925, 8180338, 9555645		★☆☆☆☆ Found in Text Mining only
Cerebrovascular Disorders	Cerebrovascular Disorders	BEFREE	8678388, 9555645		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	28927526, 29652833		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical Intraepithelial Neoplasia	Cervical Intraepithelial Neoplasia	BEFREE	17313702, 27685805		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	28927526, 29652833		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	16039715		★☆☆☆☆ Found in Text Mining only
Childhood asthma	Asthma	BEFREE	22326254		★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	10375116, 12555076, 15077159, 17238184, 23525311, 30523493, 31504825, 9215849		★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	CTD_human_DG	7661930		★☆☆☆☆ Found in Text Mining only
Childhood Oligodendroglioma	Oligodendroglioma	BEFREE	7515658		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	11260864, 12213730, 15467712, 30212390		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	12213730, 15467712, 27009864	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangitis Sclerosing	Sclerosing cholangitis	Pubtator	36252869	Associate	★☆☆☆☆ Found in Text Mining only
Cholecystolithiasis	Cholecystolithiasis	BEFREE	27748282		★☆☆☆☆ Found in Text Mining only
Cholelithiasis	Cholelithiasis	BEFREE	27748282		★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	18485586		★☆☆☆☆ Found in Text Mining only
Choroid Plexus Papilloma	Choroid Plexus Papilloma	BEFREE	16616114		★☆☆☆☆ Found in Text Mining only
Chromosomal Instability	Chromosomal instability	Pubtator	12486240, 16351465, 16815967, 20696052, 23052130, 28926134	Associate	★☆☆☆☆ Found in Text Mining only
Chronic heart failure	Heart Failure	BEFREE	28043678		★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	28551651, 31138132		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	18765431, 30601084		★☆☆☆☆ Found in Text Mining only
Chronobiology Disorders	Chronobiology disorder	Pubtator	31712236	Associate	★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	27421039, 29865038, 8402727		★☆☆☆☆ Found in Text Mining only
Citrullinemia	Citrullinemia	Pubtator	6424438	Associate	★☆☆☆☆ Found in Text Mining only
Class III malocclusion	Malocclusion	HPO_DG			★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	36374219	Associate	★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	22109555		★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	10595736, 11920497, 9490271	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	10090594, 10092300, 10507776, 10756345, 10784639, 10837025, 11221825, 11237529, 11592095, 11751382, 12000364, 12036944, 12051537, 12555076, 12584179, 12724325, 12822869, 12970888, 1310068, 1315124, 14574178, 14679305, 15051498, 15077159, 15150130, 15273719, 15316055, 15340841, 15368361, 15476557, 15507235, 15548520, 1565631, 15746039, 15754020, 15769611, 16042576, 16423286, 16982769, 18313537, 18474248, 18482722, 18592008, 19036155, 20510605, 20663863, 21057000, 21518821, 21532750, 21885812, 22658618, 23320800, 23457600, 23840886, 24651522, 24722208, 24735542, 25712450, 25885658, 26305864, 26662938, 27064876, 28576136, 28650985, 28781669, 29759553, 29964340, 30256815, 31121307, 7882361, 7903889, 8381581, 8594558, 9083931, 9182290, 9296069, 9433483, 9663391		★☆☆☆☆ Found in Text Mining only
Colonic Diseases	Colonic disease	Pubtator	12810952, 15982419, 27462886, 28179590, 9490271, 9508117	Associate	★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	10090594, 10204808, 10514384, 11181456, 12036944, 12112318, 15217933, 15733272, 16184469, 16478792, 16815967, 17116713, 18849522, 19116878, 19628463, 1977514, 24218540, 24837369, 25657017, 26631510, 27563825, 27816598, 28576136, 28730258, 30859181, 9589476		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	CTD_human_DG	10383901, 12034317, 17192441, 25200834, 26335331, 7846077, 8608549		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	10666372, 12057910, 12524418, 15190067, 16815967, 17116713, 18444242, 18767147, 18774639, 18849522, 25885658, 26631510, 28059096, 31876604, 34790819, 35937946, 36288643, 9260769	Associate	★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	LHGDN	11751382, 15375803, 15548520, 16423286, 16450383		★☆☆☆☆ Found in Text Mining only
Colonic Polyps	Colonic polyps	Pubtator	16228836, 22449158, 25496852, 30256815, 33740971	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Adenomatous Polyposis Autosomal Recessive	Colorectal adenomatous polyposis	Pubtator	24253443, 29367705, 9950370, 9973276	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	10090483, 10205208, 10343885, 10357817, 10381126, 10383126, 10397462, 10398435, 10433009, 10445854, 10490837, 10502323, 10502830, 10544223, 10555149, 10555757, 10598803, 10602369, 10630180, 10660330, 10665650, 10705390, 10717531, 10737725, 10737795, 10749138, 10756345, 10818595, 10854222, 10919662, 10923044, 10938175, 10945171, 10969779, 11048799, 11107173, 11135372, 11135435, 11159880, 11267860, 11270422, 11336166, 11354631, 11396184, 11409872, 11506490, 11516998, 11551102, 11668620, 11720476, 11751382, 11788563, 11852336, 11900252, 11933206, 11978510, 11987262, 12136240, 12173026, 12210511, 12374230, 12445134, 12499439, 12530096, 12553053, 12595050, 12633551, 12673484, 12721244, 12782759, 12810640, 12822869, 12871177, 12894596, 14578138, 14735163, 15057748, 15083323, 15087381, 15185002, 15231447, 15236166, 15245581, 1528264, 15300853, 15326380, 15340259, 15375009, 15516844, 15540296, 15702478, 15733272, 15788729, 15793634, 15929773, 16099785, 16195945, 16207479, 16219636, 16228836, 16253019, 16478792, 16525781, 16537703, 16645205, 16762487, 16875934, 16941501, 16981189, 17047077, 17116713, 17119068, 17257127, 17260021, 17293347, 17556698, 17653897, 17920230, 18061123, 18369740, 18398311, 18406876, 18433509, 18477604, 18519692, 18592008, 18593890, 18612690, 18629513, 18632657, 18716850, 18778891, 18836487, 18854359, 18977219, 18992635, 19138942, 19147861, 19164452, 19173296, 19307944, 19309276, 19376641, 19378335, 19392654, 19515250, 19543899, 19573802, 19620482, 1978564, 19847890, 19912361, 19928352, 19951906, 20007843, 20010873, 20033787, 20077021, 20210251, 20446826, 20454513, 20460455, 20513532, 20569184, 20643622, 20663899, 20707908, 20708155, 20885350, 21057000, 21061267, 21110124, 21436051, 21707509, 21769429, 21779980, 21807601, 21857949, 21901162, 22080605, 22168384, 22294761, 22294772, 22380946, 22399804, 22654442, 22796397, 22825584, 22864938, 22899370, 22990173, 23085758, 23168910, 23302090, 23318418, 23539443, 23585368, 23773491, 23824282, 23998936, 24086117, 24169521, 24253443, 24351336, 24500912, 24573033, 24616570, 24623448, 24643704, 24706189, 24795265, 24801760, 24847761, 24944469, 25025473, 25051912, 25219767, 25243122, 25250560, 25301724, 25313745, 25320087, 25432628, 25460919, 25500543, 25571954, 25773792, 25786087, 25923178, 26086041, 26169059, 26189482, 26216840, 26252958, 26305864, 26334567, 26388189, 26469098, 26559812, 26749281, 26809274, 26811627, 26880076, 26883113, 26970738, 26984550, 27063727, 27197217, 27294323, 27302369, 27325016, 27329244, 27563825, 27661107, 27798265, 27835580, 27978560, 28010732, 28105931, 28137366, 28271271, 28306719, 28515349, 28617917, 28668823, 28731177, 28791728, 28791770, 28926134, 29048416, 29048575, 29050326, 29127379, 29169144, 29237421, 29275959, 29483830, 29505855, 29525853, 29541205, 29697365, 29719120, 29743633, 29751128, 29793804, 29948642, 29967336, 30024920, 30032163, 30186819, 30239619, 30256815, 30324682, 30414835, 30511962, 30572883, 30637899, 30716341, 30730459, 30738693, 30799131, 30867802, 30983515, 31097693, 31160382, 31213502, 31283021, 31414579, 31416464, 31455888, 31485167, 31547988, 31732732, 31802619, 31804558, 7562975, 7606712, 7669739, 7927902, 7959691, 8055154, 8081386, 8259519, 8395941, 8471756, 8564980, 8665182, 8835324, 8895682, 8990002, 9000553, 9033644, 9062090, 9096643, 9207270, 9220497, 9288102, 9330602, 9407954, 9450908, 9512122, 9621517, 9679945, 9690990, 9699657, 9705533, 9724771, 9731533, 9831355, 9869602, 9869603, 9950360, 9973276		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	CLINVAR_DG	11159880, 23896379, 9288102, 9724771, 9731533		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	CTD_human_DG	12907644, 17116713, 18716850, 19309276, 21291235, 21531761, 21967605		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	GWASCAT_DG	30510241		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	GENOMICS_ENGLAND_DG			★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	10188731, 10337989, 10493496, 10545699, 10681434, 10737795, 10763829, 10969779, 11454429, 11687966, 11821507, 11867715, 12057910, 12165057, 12494469, 12533826, 12673484, 12774245, 1310068, 1338904, 15251969, 1528264, 15959913, 16158975, 17389002, 17572842, 18027849, 18224684, 19179456, 19928352, 20707908, 20708155, 21366352, 23397547, 23539443, 23846443, 24416237, 25324480, 26243311, 26764183, 27254743, 27693244, 29212857, 7923190, 8385345, 8389242, 8609698, 8649856, 8764128, 9065402, 9083931, 9422268, 9450908, 9527272, 9541486, 9724771, 9751605		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	10205208, 10347231, 10507776, 10555757, 10646887, 10665650, 10681434, 10705390, 10737795, 10854222, 11279192, 11707154, 11821507, 11972058, 12057910, 12173321, 12387883, 12414520, 12499439, 12610503, 12782759, 12838317, 12970888, 1325652, 1339098, 1347643, 14573780, 14624392, 14728717, 15039224, 15040027, 15083190, 15122305, 15141037, 15154912, 15213719, 15326380, 15331612, 15520370, 1565631, 15788729, 15802015, 15928669, 15958564, 15959913, 15982419, 16099785, 16207479, 16228836, 16299030, 16351465, 16356174, 16369045, 16545110, 16569251, 16645205, 16671995, 16798748, 16815967, 16982769, 17005722, 17116713, 17167178, 17192415, 17556698, 17595655, 17636402, 18063416, 18369740, 18414471, 18433509, 18444242, 18451217, 18498351, 18592008, 18612690, 18716850, 18794146, 18849522, 18952824, 19067193, 19125701, 19164452, 19173296, 19298008, 19337631, 19515250, 19525225, 19691111, 1978564, 20108522, 20368985, 20460455, 20682701, 20696052, 20864632, 21057000, 21279955, 21287799, 21359685, 21380628, 21460853, 21502812, 21505584, 21641392, 21857949, 21901162, 21909382, 22000517, 22014273, 22103262, 22180177, 22399804, 22509309, 22759657, 22847197, 22880157, 23085758, 23168910, 23244118, 23326336, 23405266, 23538439, 23661344, 23824282, 23840886, 23873622, 24086117, 24169521, 24244701, 24351336, 24416237, 24500500, 24599305, 24651453, 24651522, 24722208, 24861525, 24951259, 25025473, 25107489, 25243122, 25250560, 25301724, 25313745, 25352148, 25460919, 25500543, 25590978, 25617745, 25923178, 26010451, 26305864, 26375816, 26517354, 26646696, 26749281, 26764183, 26809274, 26862732, 26863316, 26883113, 26884349, 26900293, 26970738, 26991699, 27047802, 27063727, 27121310, 27158207, 27221540, 27254743, 27302369, 27384156, 27462886, 27578919, 27586204, 27595705, 27661107, 27729614, 27806309, 27978560, 28010732, 28105931, 28135145, 28222664, 28306719, 28423518, 28445943, 28546418, 28551381, 28576136, 28645942, 28926134, 29237421, 29307989, 29327707, 29505855, 29546405, 29551770, 29575536, 29697365, 29914973, 29945573, 29967336, 30024920, 30038269, 30186819, 30231850, 30239619, 30256815, 30324682, 30523670, 30572883, 30577807, 30640173, 30792186, 31015202, 31127692, 31243121, 31255173, 31364752, 31416464, 31492840, 31548566, 31723073, 31804558, 31805970, 31881079, 31884442, 31892851, 31900123, 32102509, 32142663, 32159210, 32163279, 32585361, 32627883, 32633358, 32669593, 32730818, 32733093, 32743790, 32754865, 32764203, 32788368, 32865336, 32914570, 32941008, 33008377, 33057364, 33060621, 33087131, 33177794, 33230914, 33237662, 33525395, 33632293, 33648461, 33653301, 33655327, 33714943, 33787608, 33836681, 33854094, 34092617, 34111531, 34433650, 34454113, 34599254, 34610014, 34873211, 34909835, 34911816, 34954189, 34967562, 35134211, 35143042, 35169225, 35173208, 35176763, 35338148, 35417240, 35459861, 35475677, 35477541, 35531124, 35550340, 35605119, 35618879, 35633533, 35654814, 35697349, 35709138, 35761395, 35866738, 35901658, 35904277, 35907983, 35937946, 35947664, 35978873, 35999641, 36181326, 36243179, 36308182, 36445120, 36520636, 36675180, 36812239, 36849394, 36872334, 36977982, 37017636, 37039257, 37096801, 37114476, 37146911, 37164276, 37306523, 37310750, 37319387, 37368936, 37533857, 37658412, 37848058, 38185290, 38359148, 38492821, 38521200, 39289671, 39333321, 39390564, 39587554, 39756803, 40004106, 40281443, 7798298, 7947085, 8039618, 8248216, 8512811, 8594558, 8799152, 9062090, 9260769, 9268294, 9330602, 9388195, 9398684, 9399850, 9724771, 9824584, 9973276, 9990071	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	CLINVAR_DG	10737795, 12374230, 1338904, 1528264, 17704924, 18992635, 21901162, 2281069, 22810696, 22848674, 23204322, 23700467, 24518971, 24651453, 24861525, 25157968, 8187091		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	11668620, 11920497, 11956815, 12093899, 12504226, 12647217, 12655564, 14672538, 15040027, 15326380, 15943410, 16356174, 16710723, 16951153, 17119068, 17556698, 17653897, 17704924, 17854661, 18265644, 18369740, 18451217, 18612690, 18632633, 18992635		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	CTD_human_DG	12907644, 17116713, 18716850, 19309276, 21291235, 21531761, 21967605		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	28059096, 32166754	Stimulate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	GWASCAT_DG	30510241		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	34676872, 36703617	Inhibit	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms Hereditary Nonpolyposis	Lynch syndrome	Pubtator	21287799, 24278394, 25204323, 28135145, 28548127, 32102509, 32620917, 33279946, 34003820, 37306523	Associate	★☆☆☆☆ Found in Text Mining only
Complement Component 7 Deficiency	Complement component deficiency	Pubtator	32384877	Associate	★☆☆☆☆ Found in Text Mining only
Compression of spinal cord	Spinal cord compression	HPO_DG			★☆☆☆☆ Found in Text Mining only
Cone-Rod Dystrophy 2	Cone-rod dystrophy	BEFREE	25204207		★☆☆☆☆ Found in Text Mining only
Congenital Abnormalities	Congenital abnormalities	Pubtator	22799487	Associate	★☆☆☆☆ Found in Text Mining only
Congenital anomaly of the kidney	Multicystic renal dysplasia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	12907646, 14502807, 17954272, 20179237, 30024920, 7577080		★☆☆☆☆ Found in Text Mining only
Congenital Disorders of Glycosylation	Congenital disorder of glycosylation	Pubtator	31271700	Associate	★☆☆☆☆ Found in Text Mining only
Congenital Hyperinsulinism	Congenital hyperinsulinism	Pubtator	23869231	Associate	★☆☆☆☆ Found in Text Mining only
Congenital hypoplasia of radius	Congenital Hypoplasia Of Radius	HPO_DG			★☆☆☆☆ Found in Text Mining only
Congenital neurologic anomalies	Drachtman Weinblatt Sitarz syndrome	HPO_DG			★☆☆☆☆ Found in Text Mining only
Congenital thrombotic disease, due to Protein C deficiency	Congenital Thrombotic Disease	BEFREE	11434940		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congenital thrombotic disease, due to Protein C deficiency	Congenital Thrombotic Disease	ORPHANET_DG	23521084		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congenital thrombotic disease, due to Protein C deficiency	Congenital Thrombotic Disease	CTD_human_DG	25748729		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congestive heart failure	Congestive Heart Failure	BEFREE	28043678, 30974752		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	10426194, 31686521		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	10845571, 26436499		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	10440909	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	10845571, 26436499		★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	19691480, 35075098	Associate	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	10845571, 18680534, 21804106, 26436499, 29890521		★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	LHGDN	18424361		★☆☆☆☆ Found in Text Mining only
Coronary Restenosis	Coronary restenosis	Pubtator	10440909	Associate	★☆☆☆☆ Found in Text Mining only
Craniopharyngioma	Craniopharyngioma	Pubtator	24934367	Associate	★☆☆☆☆ Found in Text Mining only
Craniopharyngioma	Craniopharyngioma	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	10563542, 12502211, 19543899, 27063727		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	27063727, 29967250	Associate	★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	BEFREE	10571045		★☆☆☆☆ Found in Text Mining only
Deep Vein Thrombosis	Thrombosis	BEFREE	10414451, 11776306, 11943931, 15978099, 17890946, 18954896, 21362311, 23015030, 25393254, 26372516, 26982741, 27197074, 29196248, 29672822, 31295762, 8136274, 8164741, 8547095, 8732627, 8899255, 9065990, 9690807		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Deep Vein Thrombosis	Thrombosis	CTD_human_DG	12730085, 25748729		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Deep Vein Thrombosis	Thrombosis	CLINVAR_DG	31064749		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Deep Vein Thrombosis	Thrombosis	HPO_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depression, Bipolar	Bipolar Disorder	CTD_human_DG	31043756		★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Major depressive disorder	Pubtator	10665650	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	Pubtator	27769064	Associate	★☆☆☆☆ Found in Text Mining only
Dermatopathia pigmentosa reticularis	Dermatopathia pigmentosa reticularis	Pubtator	7485167	Associate	★☆☆☆☆ Found in Text Mining only
Desmoid disease hereditary	Desmoid tumor	Pubtator	10077047, 11247896, 15542524, 17090192, 21931686, 22449158, 23561487, 26171757, 27158207, 28282712, 31591141, 32281046, 33213169, 35180772, 37318496, 8940264, 9250146, 9736021	Associate	★☆☆☆☆ Found in Text Mining only
Desmoid disease, hereditary	Desmoid Disease, Hereditary	BEFREE	10077730, 21931686, 8940264, 8968744		★☆☆☆☆ Found in Text Mining only
Desmoid disease, hereditary	Desmoid Disease, Hereditary	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Desmoid disease, hereditary	Desmoid Disease, Hereditary	GENOMICS_ENGLAND_DG			★☆☆☆☆ Found in Text Mining only
Desmoid disease, hereditary	Desmoid Disease, Hereditary	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Desmoid tumor	Desmoid tumor	Orphanet			★☆☆☆☆ Found in Text Mining only
Desmoid Tumor Caused By Somatic Mutation	Desmoid Tumor	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Desmoplastic Medulloblastoma	Medulloblastoma	CTD_human_DG	7661930		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	15240665, 17982464, 24559924, 28724247, 29362846, 9597748		★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	36698149	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	15240665, 17982464, 24559924, 28724247, 29362846, 9597748		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	19296078	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	31591436	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	11380450	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	11380450	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	19296078	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	18180619, 20668683, 24559924, 28348273, 29055002		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	29362846, 29535389, 30735960, 31560710		★☆☆☆☆ Found in Text Mining only
Diabetic Angiopathies	Diabetic angiopathies	Pubtator	31271700	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	17982464, 28687614		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	LHGDN	17982464		★☆☆☆☆ Found in Text Mining only
Diarrhea	Diarrhea	Pubtator	11247896	Associate	★☆☆☆☆ Found in Text Mining only
Diarrhea 5 With Tufting Enteropathy Congenital	Congenital diarrhea	Pubtator	12414520	Associate	★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	11756145, 31089208, 31631067		★☆☆☆☆ Found in Text Mining only
Disseminated Intravascular Coagulation	Disseminated Intravascular Coagulation	BEFREE	10997987, 15992667, 16496494, 22416129, 22728069, 24158118, 26436558, 2961308, 29683961, 30208259, 30296833, 31140293, 3590079		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Disseminated Intravascular Coagulation	Disseminated Intravascular Coagulation	CTD_human_DG	18376272		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Disseminated Intravascular Coagulation	Disseminated intravascular coagulation	Pubtator	29257196	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ductal Breast Carcinoma	Breast Carcinoma	BEFREE	29483830		★☆☆☆☆ Found in Text Mining only
Ductal Carcinoma	Ductal Carcinoma	BEFREE	29483830		★☆☆☆☆ Found in Text Mining only
Duodenal polyposis	Duodenal polyposis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Duodenal polyposis	Duodenal polyposis	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Duodenitis	Duodenitis	Pubtator	12057910, 29901124, 32770675	Associate	★☆☆☆☆ Found in Text Mining only
Duodenitis	Duodenitis	Pubtator	15623495	Inhibit	★☆☆☆☆ Found in Text Mining only
Dyslexia	Dyslexia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Dystonic Disorders	Dystonia	Pubtator	17595655, 17962810	Associate	★☆☆☆☆ Found in Text Mining only
Ectodermal Dysplasia	Ectodermal dysplasia	Pubtator	11891193	Associate	★☆☆☆☆ Found in Text Mining only
ECTRODACTYLY, ECTODERMAL DYSPLASIA, AND CLEFT LIP/PALATE SYNDROME 1	Ectrodactyly	BEFREE	22907428		★☆☆☆☆ Found in Text Mining only
Ectropion	Ectropion	HPO_DG			★☆☆☆☆ Found in Text Mining only
Endocarditis	Endocarditis	BEFREE	28444279		★☆☆☆☆ Found in Text Mining only
Endometrial adenocarcinoma	Endometrial Adenocarcinoma	BEFREE	15287021		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	10411147, 12439748, 17089036, 19900189, 31450893		★☆☆☆☆ Found in Text Mining only
Endometrial Hyperplasia	Endometrial Hyperplasia	BEFREE	12097272, 21363919		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial Neoplasms	LHGDN	12439748		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	28440489, 31450893, 36745477	Associate	★☆☆☆☆ Found in Text Mining only
Ependymoma	Ependymoma	BEFREE	16616114, 16843107		★☆☆☆☆ Found in Text Mining only
Ependymoma	Ependymoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Epidermodysplasia Verruciformis	Epidermodysplasia verruciformis	Pubtator	37427430	Associate	★☆☆☆☆ Found in Text Mining only
Epiretinal Membrane	Epiretinal Membrane	BEFREE	15218453		★☆☆☆☆ Found in Text Mining only
Epiretinal Membrane	Epiretinal Membrane	HPO_DG			★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	29653924, 31829231		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	18847451, 19023234, 19259700, 29440928, 29776635, 8536888		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	1423299, 18847451, 19023234, 19259700, 29440928, 29776635, 7958689		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	1565631, 19448414, 7958689, 8509434	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	19448414, 25514805	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	29866946, 30350313	Inhibit	★☆☆☆☆ Found in Text Mining only
Exophthalmos	Proptosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Fabry Disease	Fabry disease	Pubtator	12111782	Inhibit	★☆☆☆☆ Found in Text Mining only
Factor V Deficiency	Factor v deficiency	Pubtator	11564076, 15043529, 7780127, 9067500	Associate	★☆☆☆☆ Found in Text Mining only
Factor V Deficiency	Factor v deficiency	Pubtator	16359508	Inhibit	★☆☆☆☆ Found in Text Mining only
Factor X Deficiency	Factor x deficiency	Pubtator	28302935	Associate	★☆☆☆☆ Found in Text Mining only
Familial adenomatous polyposis due to 5q22.2 microdeletion	Adenomatous Polyposis	Orphanet			★☆☆☆☆ Found in Text Mining only
Familial cylindromatosis	Familial cylindromatosis	Pubtator	27067780	Associate	★☆☆☆☆ Found in Text Mining only
Familial Intestinal Polyposis	Multiple polyposis syndrome	CTD_human_DG	11040535, 11420398, 11588890, 11766074, 12394442, 17942926, 18704758, 25200834, 25280562, 28414304, 8071957		★☆☆☆☆ Found in Text Mining only
Familial medullary thyroid carcinoma	Thyroid cancer	Pubtator	26530882	Associate	★☆☆☆☆ Found in Text Mining only
Familial multiple trichoepitheliomata	Multiple Trichoepithelioma	BEFREE	11016622, 16278815, 18831746, 27067780		★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty liver	Pubtator	34082137	Associate	★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	28890136		★☆☆☆☆ Found in Text Mining only
Fibroadenoma of breast	Fibroadenoma Of Breast	HPO_DG			★☆☆☆☆ Found in Text Mining only
Fibrolamellar Hepatocellular Carcinoma	Hepatocellular Carcinoma	BEFREE	21060828		★☆☆☆☆ Found in Text Mining only
fibroma	Fibroma	LHGDN	17558858		★☆☆☆☆ Found in Text Mining only
Fibromatosis	Fibromatosis	BEFREE	10834386, 11455002, 11823972, 18715618, 24378386		★☆☆☆☆ Found in Text Mining only
Fibromatosis, Abdominal	Fibromatosis	CTD_human_DG	10686957		★☆☆☆☆ Found in Text Mining only
Fibromatosis, Abdominal	Fibromatosis	BEFREE	9250146		★☆☆☆☆ Found in Text Mining only
Fibromatosis, Aggressive	Fibromatosis	BEFREE	10367940, 10597266, 10782927, 11823972, 12445067, 15542524, 15793634, 17135276, 17426470, 17916546, 18224684, 18704758, 18715618, 20232483, 20352275, 21904137, 21931686, 22305464, 23604857, 25174682, 26171757, 26179480, 28668823, 31807167, 7795585, 8150351, 8221638, 8608492, 8835324, 8968744, 9250146, 9744495		★☆☆☆☆ Found in Text Mining only
Fibromatosis, Aggressive	Fibromatosis	CTD_human_DG	11816139		★☆☆☆☆ Found in Text Mining only
Fibromatosis, Aggressive	Fibromatosis	LHGDN	15832580, 17952864, 18770064		★☆☆☆☆ Found in Text Mining only
Fibromatosis, Aggressive	Fibromatosis	CGI_DG			★☆☆☆☆ Found in Text Mining only
Fibromatosis, Aggressive	Fibromatosis	ORPHANET_DG			★☆☆☆☆ Found in Text Mining only
Fibromatosis, Aggressive	Fibromatosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Fibromatosis, Aggressive	Fibromatosis	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	BEFREE	19296078		★☆☆☆☆ Found in Text Mining only
Follicular adenoma	Adenoma	CTD_human_DG	10383901, 12034317, 19092804, 30188895, 9111214		★☆☆☆☆ Found in Text Mining only
Follicular thyroid carcinoma	Follicular Thyroid Carcinoma	BEFREE	11696170, 23604857		★☆☆☆☆ Found in Text Mining only
Fourth cranial nerve paresis	Cranial Nerve Paralysis	BEFREE	21315632		★☆☆☆☆ Found in Text Mining only
Frontal bossing	Frontal bossing	HPO_DG			★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	26715268, 27450454, 27748282		★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	25066711, 26715268	Associate	★☆☆☆☆ Found in Text Mining only
Gangrene	Gangrene	HPO_DG			★☆☆☆☆ Found in Text Mining only
Gardner Syndrome	Gardner Syndrome	BEFREE	11145293, 11455002, 1324739, 14616385, 15095859, 16411234, 1651563, 1665706, 19617769, 20141232, 20232483, 27291484, 27799065, 28782241, 30269086, 7485167		★☆☆☆☆ Found in Text Mining only
Gardner syndrome	Gardner Syndrome	Orphanet			★☆☆☆☆ Found in Text Mining only
Gardner Syndrome	Gardner Syndrome	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Gardner Syndrome	Gardner Syndrome	GENOMICS_ENGLAND_DG			★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	BEFREE	27087319, 8564980		★☆☆☆☆ Found in Text Mining only
Gastric adenocarcinoma and proximal polyposis of the stomach	Gastric Adenocarcinoma And Proximal Polyposis Of The Stomach	Orphanet			★☆☆☆☆ Found in Text Mining only
Gastrinoma	Gastrinoma	BEFREE	17278096		★☆☆☆☆ Found in Text Mining only
Gastritis, Atrophic	Gastritis	BEFREE	25935328		★☆☆☆☆ Found in Text Mining only
Gastrointestinal carcinoma	Gastrointestinal carcinoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Gastrointestinal Diseases	Gastrointestinal disease	Pubtator	12057910	Associate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal Neoplasms	BEFREE	10383166, 11809682, 9808525		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal neoplasm	Pubtator	1565631, 29307989	Associate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal Neoplasms	CTD_human_DG	21297660		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	BEFREE	23786773		★☆☆☆☆ Found in Text Mining only
Genitourinary Cancer	Genitourinary Cancer	BEFREE	16170165		★☆☆☆☆ Found in Text Mining only
Germ cell tumor	Tumor	BEFREE	21225915		★☆☆☆☆ Found in Text Mining only
Giant Cell Glioblastoma	Giant Cell Glioblastoma	CTD_human_DG	7661930		★☆☆☆☆ Found in Text Mining only
Glaucoma Angle Closure	Angle closure glaucoma	Pubtator	22096540	Associate	★☆☆☆☆ Found in Text Mining only
Glaucoma Open Angle	Open angle glaucoma	Pubtator	34348663	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	17905526, 26074073, 30175510, 31036696		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	26191234, 36662405, 37400829	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	CTD_human_DG	7661930		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	26074073, 30175510, 31036696		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	CTD_human_DG	7661930		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	25243911, 30283018, 33947134	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	30175510, 9215849		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	CGI_DG			★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	HPO_DG			★☆☆☆☆ Found in Text Mining only
Glomerulonephritis Membranous	Membranous glomerulonephritis	Pubtator	36588134	Inhibit	★☆☆☆☆ Found in Text Mining only
Glycogen Storage Disease XIV	Glycogen storage disease	Pubtator	40225925	Associate	★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	29535719	Associate	★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	15699110, 23299798, 29272282, 31243040		★☆☆☆☆ Found in Text Mining only
Growth Disorders	Growth disorder	Pubtator	15213719	Associate	★☆☆☆☆ Found in Text Mining only
Hamartoma Syndrome, Multiple	Hamartoma	BEFREE	16292097		★☆☆☆☆ Found in Text Mining only
Hamartomatous polyposis	Hamartomatous polyposis	BEFREE	10502830, 11103790		★☆☆☆☆ Found in Text Mining only
Hearing Loss Sensorineural	Hearing loss	Pubtator	15869586	Associate	★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	10749862	Associate	★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	30974752		★☆☆☆☆ Found in Text Mining only
HELLP Syndrome	HELLP Syndrome	BEFREE	29563339		★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	9083931		★☆☆☆☆ Found in Text Mining only
Hemophilia A	Hemophilia a	Pubtator	12091341, 16015419, 17059471, 29884816, 8695835	Associate	★☆☆☆☆ Found in Text Mining only
Hemophilia A	Hemophilia	BEFREE	19175419, 27789479, 28632502, 28750471, 28932824, 29884816, 30015643, 30125997, 3137981		★☆☆☆☆ Found in Text Mining only
Hemophilia B	Hemophilia b	Pubtator	16015419	Associate	★☆☆☆☆ Found in Text Mining only
Hemophilia, NOS	Hemophilia	BEFREE	19175419, 27789479, 28632502, 28750471, 28932824, 29884816, 30015643, 3137981		★☆☆☆☆ Found in Text Mining only
Hemorrhage	Hemorrhage	Pubtator	1569192, 16015419, 17059471, 17255099, 19139080, 19144654, 25204207, 28302935, 36935364	Associate	★☆☆☆☆ Found in Text Mining only
Hemorrhage	Hemorrhage	Pubtator	30450637	Inhibit	★☆☆☆☆ Found in Text Mining only
Hepatic Vein Thrombosis	Hepatic Vein Thrombosis	BEFREE	10378363		★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	18803358, 20070500	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis B Chronic	Hepatitis b	Pubtator	17900245, 20070500, 25788186, 26577140	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis C Chronic	Hepatitis c	Pubtator	22577025	Associate	★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	BEFREE	10398436, 10812168, 14522379, 14654913, 16126064, 16317745, 17047077, 17962810, 20210251, 22692730, 23715166, 29190888, 29251405, 29719120, 30619485, 30836352, 7585543, 8764128, 9038672		★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	Pubtator	11896079, 17962810, 9038672	Associate	★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	CGI_DG			★☆☆☆☆ Found in Text Mining only
Hepatocellular Adenoma	Hepatocellular adenoma	BEFREE	12297840		★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	10901363, 11437404, 21279955, 23637229, 30306255	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary Breast And Ovarian Cancer Syndrome	BEFREE	17935271		★☆☆☆☆ Found in Text Mining only
Hereditary Diffuse Gastric Cancer	Gastric Cancer	BEFREE	11399952, 21134075		★☆☆☆☆ Found in Text Mining only
Hereditary Diffuse Gastric Cancer	Gastric Cancer	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Hereditary hemochromatosis	Hereditary Hemochromatosis	BEFREE	17412760		★☆☆☆☆ Found in Text Mining only
Hereditary Malignant Neoplasm	Hereditary cancer	BEFREE	25832318		★☆☆☆☆ Found in Text Mining only
Hereditary Nonpolyposis Colorectal Cancer	Colorectal Cancer	BEFREE	10493496, 11135435, 15264268, 15475941, 15788729, 15929773, 1643645, 16762487, 17908962, 18629513, 19766128, 19931546, 20532534, 21134075, 21287799, 22080605, 22552011, 24278394, 25822476, 28573495, 29124495, 30324682, 7661930, 7903889, 8644741, 8690195, 9062584, 9242220, 9385369		★☆☆☆☆ Found in Text Mining only
Hereditary Nonpolyposis Colorectal Cancer	Colorectal Cancer	CTD_human_DG	7661930		★☆☆☆☆ Found in Text Mining only
Hereditary nonpolyposis colorectal carcinoma	Hereditary nonpolyposis colorectal cancer	BEFREE	1643645		★☆☆☆☆ Found in Text Mining only
Hereditary nonpolyposis colorectal carcinoma	Hereditary nonpolyposis colorectal cancer	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hereditary Nonpolyposis Colorectal Neoplasms	Colorectal Neoplasms	CTD_human_DG	7661930		★☆☆☆☆ Found in Text Mining only
Hereditary pancreatitis	Hereditary Pancreatitis	BEFREE	31529234		★☆☆☆☆ Found in Text Mining only
Hereditary pyropoikilocytosis	Hereditary pyropoikilocytosis	BEFREE	21699772		★☆☆☆☆ Found in Text Mining only
Hereditary spherocytosis	Hereditary Spherocytosis	BEFREE	12560926		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	31138132		★☆☆☆☆ Found in Text Mining only
Holocarboxylase Synthetase Deficiency	Holocarboxylase Synthetase Deficiency	BEFREE	6794361		★☆☆☆☆ Found in Text Mining only
Homocystinuria	Homocystinuria	BEFREE	8592550		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	31138132		★☆☆☆☆ Found in Text Mining only
Hydronephrosis	Hydronephrosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hyperaldosteronism	Hyperaldosteronism	BEFREE	18247045		★☆☆☆☆ Found in Text Mining only
Hyperammonemia	Hyperammonemia	Pubtator	6424438	Associate	★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	BEFREE	17556698		★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	Pubtator	26768629	Associate	★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	28710665, 31006591		★☆☆☆☆ Found in Text Mining only
Hyperhomocysteinemia	Hyperhomocysteinemia	BEFREE	10625206, 11395124, 11514392, 18066962, 21586893		★☆☆☆☆ Found in Text Mining only
Hyperhomocysteinemia	Hyperhomocysteinemia	LHGDN	12200374		★☆☆☆☆ Found in Text Mining only
Hyperhomocysteinemia	Hyperhomocysteinemia	Pubtator	20935614	Associate	★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	19116878		★☆☆☆☆ Found in Text Mining only
Hyperlipidemia	Hyperlipidemia	BEFREE	16478792, 27769066, 8774498		★☆☆☆☆ Found in Text Mining only
Hyperlipidemia	Hyperlipidemia	CTD_human_DG	17546600		★☆☆☆☆ Found in Text Mining only
Hyperlysinemias	Hyperlysinemia	BEFREE	6424438		★☆☆☆☆ Found in Text Mining only
Hyperlysinemias	Hyperlipidemia	Pubtator	6424438	Associate	★☆☆☆☆ Found in Text Mining only
Hyperparathyroidism	Hyperparathyroidism	BEFREE	26163537		★☆☆☆☆ Found in Text Mining only
Hyperparathyroidism, Primary	Hyperparathyroidism	BEFREE	31486992		★☆☆☆☆ Found in Text Mining only
Hyperplastic colonic polyposis	Hyperplastic colonic polyposis	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Hypersensitivity Immediate	Hypersensitivity	Pubtator	30975910, 31338992, 7919373, 8704244	Associate	★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	32013702	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	CTD_human_DG	22352330		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	BEFREE	23011394, 27648962, 29712742		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperthyroidism	Hyperthyroidism	Pubtator	37876543	Associate	★☆☆☆☆ Found in Text Mining only
Hyperthyroidism	Hyperthyroidism	BEFREE	9597748		★☆☆☆☆ Found in Text Mining only
Hyperuricemia	Hyperuricemia	BEFREE	30622076		★☆☆☆☆ Found in Text Mining only
Hypodontia	Hypodontia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	BEFREE	29483297, 29535389		★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	Pubtator	34248840	Associate	★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hypoplasia of optic disc	Hypoplasia Of Optic Disc	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hypoplasia of thumb	Hypoplasia Of Thumb	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	21502812	Inhibit	★☆☆☆☆ Found in Text Mining only
Hypoxic-Ischemic Encephalopathy	Hypoxic-Ischemic Encephalopathy	BEFREE	30225791		★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	27864558		★☆☆☆☆ Found in Text Mining only
Infantile Spasm	Infantile Spasms	BEFREE	27852007		★☆☆☆☆ Found in Text Mining only
Infertility Male	Male infertility	Pubtator	32614269	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	10445854, 10563542, 11354631, 15057748, 15947551, 17671721, 22109555, 25773792, 26764183, 9433483		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	12057910, 25878173, 32229654	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	LHGDN	17557119, 18457995		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	CTD_human_DG	18716850		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	26764183	Inhibit	★☆☆☆☆ Found in Text Mining only
Inflammatory Breast Carcinoma	Breast Cancer	BEFREE	18841156, 19829046		★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	11693343, 9585002		★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Intellectual developmental disorder	Pubtator	39756803	Associate	★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	CTD_human_DG	8071957		★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	HPO_DG			★☆☆☆☆ Found in Text Mining only
Intestinal Cancer	Intestinal Cancer	CTD_human_DG	14706516, 16962818, 19092804, 26335331, 27840820, 9111214		★☆☆☆☆ Found in Text Mining only
Intestinal Cancer	Intestinal Cancer	BEFREE	18391979, 18425817, 22308460, 27941798, 28786349		★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal disease	Pubtator	20345486, 31876604, 32669593	Associate	★☆☆☆☆ Found in Text Mining only
Intestinal Neoplasms	Intestinal Neoplasms	BEFREE	10868458, 11809809, 19578404, 21398423, 21885812, 22080605, 23393221, 24338666, 25636467, 25657017, 27939883, 28418886, 31547988, 7478622, 7954428, 9054624, 9527272		★☆☆☆☆ Found in Text Mining only
Intestinal Neoplasms	Intestinal Neoplasms	CTD_human_DG	14706516, 16962818, 19092804, 26335331, 27840820, 9111214		★☆☆☆☆ Found in Text Mining only
Intestinal Neoplasms	Intestinal neoplasm	Pubtator	18425817, 24704829	Associate	★☆☆☆☆ Found in Text Mining only
Intestinal Obstruction	Intestinal Obstruction	HPO_DG			★☆☆☆☆ Found in Text Mining only
Intestinal Polyposis	Intestinal polyposis	Pubtator	11867715, 12010888, 1325652, 15083190, 21287799, 22851115, 23561487, 24675673, 25204323, 25604157, 26446593, 29367705, 31527860, 33827469, 8213830, 9445111	Associate	★☆☆☆☆ Found in Text Mining only
Intestinal Polyposis	Intestinal Polyposis	BEFREE	16478792, 19573802, 30919136, 9022130, 9731533		★☆☆☆☆ Found in Text Mining only
Intestinal Polyposis	Intestinal Polyposis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Intestinal Polyps	Intestinal polyps	Pubtator	33525395	Associate	★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial Aneurysm	BEFREE	30808715		★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial aneurysm	Pubtator	35627118, 40103236	Associate	★☆☆☆☆ Found in Text Mining only
Intracranial Embolism	Intracranial embolism	Pubtator	18160601	Associate	★☆☆☆☆ Found in Text Mining only
Intracranial Hemorrhages	Intracranial hemorrhage	Pubtator	27172833	Associate	★☆☆☆☆ Found in Text Mining only
Intracranial Hemorrhages	Intracranial hemorrhage	Pubtator	30450637	Inhibit	★☆☆☆☆ Found in Text Mining only
Intracranial Thrombosis	Intracranial thrombosis	Pubtator	18160601, 24782131	Associate	★☆☆☆☆ Found in Text Mining only
Intraepithelial Neoplasia	Intraepithelial Neoplasia	BEFREE	12414520		★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	10212000		★☆☆☆☆ Found in Text Mining only
Intussusception	Intussusception	BEFREE	12522539		★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	BEFREE	18662704		★☆☆☆☆ Found in Text Mining only
Iron deficiency anemia	Iron deficiency anemia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Iron Overload	Iron Overload	BEFREE	17700530		★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	19057019, 19166505, 21512172, 22477541, 22976599, 25032959, 26084674, 28923278, 29343482, 29866816, 30718498, 31348046		★☆☆☆☆ Found in Text Mining only
Juvenile polyp	Polyp	BEFREE	15447767, 15557107, 9060832		★☆☆☆☆ Found in Text Mining only
Juvenile Polyposis Coli	Juvenile polyposis syndrome	BEFREE	15557107, 9382065		★☆☆☆☆ Found in Text Mining only
Juvenile polyposis syndrome	Polyposis Syndrome	BEFREE	9382065		★☆☆☆☆ Found in Text Mining only
Keratosis	Keratosis	Pubtator	26319365	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	17982464, 23443294		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	30603001	Inhibit	★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	28551651		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	27725787, 34543281	Associate	★☆☆☆☆ Found in Text Mining only
Laryngomalacia	Laryngomalacia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Leiomyosarcoma of uterus	Leiomyosarcoma Of Uterus	HPO_DG			★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	23733339, 29518763	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	27374082	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	27374082		★☆☆☆☆ Found in Text Mining only
Leukodystrophy	Leukodystrophy	HPO_DG			★☆☆☆☆ Found in Text Mining only
Leukomalacia, Periventricular	Periventricular Leukomalacia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Leukopenia	Leukopenia	BEFREE	10744154		★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	9769393		★☆☆☆☆ Found in Text Mining only
Lipid Metabolism Disorders	Lipid Metabolism Disorders	BEFREE	31514003		★☆☆☆☆ Found in Text Mining only
Lipoma	Lipoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
liposarcoma	Liposarcoma	BEFREE	16858687		★☆☆☆☆ Found in Text Mining only
Liposarcoma Myxoid	Liposarcoma	Pubtator	31702654	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	10381126, 10595907, 11429783, 11466687, 12845670, 12937151, 14507645, 15064734, 15067328, 16897741, 17030191, 17973119, 18351580, 18691570, 19332050, 21060828, 22073196, 22943463, 22995332, 23428864, 24564909, 25893304, 26034368, 29865038, 30639375, 31612394, 7903205, 8402727		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	16493481, 18691570, 27421039, 29865038, 8402727		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	20070500, 22577025, 26577140, 28376292, 28902288	Associate	★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	25788186	Associate	★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	9332318	Inhibit	★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	28376292	Associate	★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	15287021, 23715166, 24599305, 30639375, 9041254		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	CTD_human_DG	27064257		★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	15146565		★☆☆☆☆ Found in Text Mining only
Lung Diseases, Obstructive	Lung Diseases	HPO_DG			★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	11809682		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	CTD_human_DG	18337602		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	24448687		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	31182981, 34257703	Associate	★☆☆☆☆ Found in Text Mining only
Lupus anticoagulant disorder	Lupus anticoagulant	BEFREE	10414451, 10937805, 11414631, 16061602, 19004141, 19029633, 19940469, 20707729, 25656775, 2961308, 7631299, 7703480, 8052955, 9217178, 9299854		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	12353314, 22273845		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	12555213, 39969330	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	15934123	Stimulate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	12353314		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	12353314, 29303701		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus nephritis	Pubtator	37583695	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	12353314		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	15257316, 22695536, 24205493, 26900293, 27706614, 31723073, 38019243	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	17242701	Inhibit	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	23534709		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	34857895	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	8724537		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	28535466		★☆☆☆☆ Found in Text Mining only
Lynch Syndrome	Lynch Syndrome	BEFREE	15264268, 18629513, 19931546, 21134075, 21287799, 22080605, 22552011, 25822476, 28573495, 29124495, 30324682		★☆☆☆☆ Found in Text Mining only
Lynch Syndrome	Lynch Syndrome	CTD_human_DG	7661930		★☆☆☆☆ Found in Text Mining only
Malabsorption Syndrome	Malabsorption Syndrome	HPO_DG			★☆☆☆☆ Found in Text Mining only
Malignant Central Nervous System Neoplasm	Malignant neoplasm of the central nervous system	CGI_DG			★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	BEFREE	15639718		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	10555757, 10854222, 11179484, 11437404, 11448917, 11880707, 15251938, 15508191, 15671542, 16273236, 16924228, 17065059, 17301249, 18283316, 18398311, 18708403, 18841156, 19829046, 19891966, 19921426, 20226036, 20490964, 21383541, 21901790, 22026417, 22037257, 22359284, 23219837, 23869875, 25684670, 26070193, 26407953, 26945992, 27191268, 27890529, 27936456, 27983523, 28349825, 29024812, 29297603, 30005601, 30720232, 8061582, 8318422, 9679946, 9690990		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	10411147, 12439748, 17089036, 31450893		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	1565631, 18847451, 19023234, 19259700, 29440928, 29776635, 7958689		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	14527906, 26715268, 27450454, 27748282, 30807303		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	10383166, 19607815		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	CTD_human_DG	21297660		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of large intestine	Colorectal Neoplasms	GWASCAT_DG	30510241		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of large intestine	Colorectal Neoplasms	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	CTD_human_DG	27064257		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	29144570		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	10528207, 10549031, 10854222, 12455028, 1348017, 15146565, 18996677, 21229606, 22542170, 26350096, 26631510, 28497891, 28938637, 29697365, 30674939, 7585453, 8943812		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	CTD_human_DG	18337602		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	9769393		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of nasopharynx	Nasopharyngeal carcinoma	BEFREE	28543390		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	15316055, 24078348, 24761891, 31737207, 8019564, 9679945		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	1423316, 15264268, 19023234, 19150414, 22110720, 27838800, 31391772, 31540078, 8187088, 8406987		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	CGI_DG			★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	11921277, 12856637, 15930345, 16170165, 16446401, 16537703, 16956712, 17947477, 18242387, 21207416, 21944123, 22999998, 23299921, 24651255, 26860439, 29660369, 30373654, 31165705, 31646760, 7928631, 8609698, 9690990, 9778625		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	17363566, 29610475		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	HPO_DG			★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	10485468, 10605402, 11756228, 12378616, 12695555, 12746473, 1317264, 1338691, 20179237, 22246241, 23049225, 25210923, 26033320, 26073472, 30376837, 30474112, 8406987, 8855982, 9808525, 9990480		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	HPO_DG			★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	CGI_DG			★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	19036155, 28410400, 9916927		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	18006010, 19522860, 21680534, 30568459, 30868894, 8632608, 9221807		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10612827, 10738270, 10749615, 10756345, 10818595, 10837025, 11062151, 11067897, 11135435, 11448917, 11528255, 11720476, 11945149, 12007186, 12502211, 12524552, 12856637, 12894559, 12901725, 12966349, 1325301, 14999774, 1528264, 15300854, 15375009, 15475941, 15788729, 15923435, 15942635, 16043258, 16157203, 16478792, 16525781, 16798748, 17116713, 17194181, 17653897, 17681772, 18160396, 18482722, 18485586, 18539961, 18542073, 18629513, 19149902, 19179456, 19576232, 19607815, 19891966, 19900189, 19966865, 20051132, 20149637, 20179237, 21225233, 21359685, 21471006, 21665989, 22262720, 22294772, 22795047, 23055343, 23918447, 24161956, 24677392, 25496852, 25979483, 26068095, 26302408, 26421687, 26937901, 27063727, 27221540, 27314294, 27325016, 27566570, 27758879, 27890529, 28002797, 28069571, 28497891, 28535466, 28668823, 28730258, 28762545, 28829967, 28866477, 29148535, 29212857, 29362846, 29406563, 29804063, 30008838, 30535704, 30674939, 30794774, 30874463, 30906653, 30919136, 31001249, 31292541, 31433512, 31652364, 31786671, 31812762, 7478622, 7562975, 7928631, 8512811, 8834176, 8895682, 8903471, 8950667, 9143408, 9566701, 9601641, 9869602, 9869603, 9973276, 9990480		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	CGI_DG			★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	28927526, 29652833		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	10090594, 10092300, 10201372, 10507776, 10756345, 10784639, 10837025, 11062151, 11221825, 11237529, 11592095, 11751382, 12000364, 12036944, 12051537, 12414619, 12555076, 12584179, 12822869, 12970888, 1310068, 1315124, 1355210, 14574178, 14679305, 15051498, 15077159, 15131404, 15150130, 15273719, 15316055, 15340841, 15368361, 15386372, 15476557, 15507235, 15548520, 1565631, 15746039, 15754020, 15769611, 16042576, 16423286, 16982769, 18160396, 18313537, 18474248, 18482722, 18592008, 19036155, 19470789, 20510605, 20663863, 21057000, 21460853, 21518821, 21532750, 21885812, 22341439, 22658618, 23320800, 23520519, 23708654, 23840886, 24651522, 24722208, 24735542, 25712450, 26305864, 26662938, 27064876, 27729614, 28414304, 28576136, 28650985, 28781669, 29759553, 30256815, 7882361, 7903889, 8381581, 8594558, 8990193, 9083931, 9182290, 9196022, 9296069, 9433483, 9663391		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	CTD_human_DG	10383901, 12034317, 17192441, 25200834, 26335331, 7846077, 8608549		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	GWASCAT_DG	30510241		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	HPO_DG			★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	BEFREE	22321166, 7489240, 7705844		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	12800196, 15020226, 15251938, 18708403, 18841156		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	18841156		★☆☆☆☆ Found in Text Mining only
Manic	Manic Disorder	CTD_human_DG	31043756		★☆☆☆☆ Found in Text Mining only
Manic Disorder	Manic Disorder	CTD_human_DG	31043756		★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	31089208		★☆☆☆☆ Found in Text Mining only
Marfan Syndrome	Marfan syndrome	Pubtator	32961817	Associate	★☆☆☆☆ Found in Text Mining only
Marinesco-Sjogren syndrome	Marinesco-Sjogren Syndrome	BEFREE	12378616, 12499439, 15802015, 20544848, 26305864, 27325016		★☆☆☆☆ Found in Text Mining only
Medullary carcinoma of thyroid	Megalencephaly, Polymicrogyria, Polydactyly, Hydrocephalus Syndrome	BEFREE	29518763		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	10375116, 10759189, 12555076, 15077159, 16258095, 16843107, 17238184, 17373666, 17455096, 19293793, 23525311, 24115570, 27592301, 30523493, 31504825, 9215849		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	UNIPROT_DG	10666372		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	10666372, 29753700, 30523493, 32056145, 36181537, 7661930	Associate	★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	CTD_human_DG	7661930		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Medullomyoblastoma	Medullomyoblastoma	CTD_human_DG	7661930		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	10699468, 15257316, 35552752, 36739402, 38246221	Associate	★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	11198475, 15133491, 18384130, 26329581, 28535466, 9531276		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	12124804, 15133491, 15257316, 18384130		★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	18211945, 32483240	Associate	★☆☆☆☆ Found in Text Mining only
Melanotic medulloblastoma	Medulloblastoma	CTD_human_DG	7661930		★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	18066497, 27630299, 29518763		★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	LHGDN	18066497		★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	29518763, 31470906, 36662405	Associate	★☆☆☆☆ Found in Text Mining only
Mental deficiency	Mental retardation	CTD_human_DG	8071957		★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	22795047		★☆☆☆☆ Found in Text Mining only
Mental Retardation	Mental retardation	BEFREE	11693343, 9585002		★☆☆☆☆ Found in Text Mining only
Merkel cell carcinoma	Merkel cell carcinoma	BEFREE	17214850, 8406987		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	CTD_human_DG	17659810		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	Pubtator	29518763	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	29434588		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	35843982	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	38246221	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	29362846		★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	BEFREE	31441503		★☆☆☆☆ Found in Text Mining only
Micrognathism	Micrognathism	HPO_DG			★☆☆☆☆ Found in Text Mining only
Micromelia	Micromelia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Micronodular cirrhosis	Micronodular cirrhosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Microstomia	Microstomia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Mild Mental Retardation	Mental retardation	HPO_DG			★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	BEFREE	11119756, 20007506, 9350638		★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	32923630	Stimulate	★☆☆☆☆ Found in Text Mining only
Moderate intellectual disability	Mental retardation	HPO_DG			★☆☆☆☆ Found in Text Mining only
Mosaic variegated aneuploidy syndrome	Mosaic variegated aneuploidy	Pubtator	15623561	Associate	★☆☆☆☆ Found in Text Mining only
Mosaic variegated aneuploidy syndrome	Mosaic Variegated Aneuploidy	BEFREE	21190457		★☆☆☆☆ Found in Text Mining only
Mosaic variegated aneuploidy syndrome 1	Mosaic Variegated Aneuploidy	BEFREE	21190457		★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	20450124, 29037125	Associate	★☆☆☆☆ Found in Text Mining only
Mucinous Adenocarcinoma	Mucinous Adenocarcinoma	BEFREE	15703832		★☆☆☆☆ Found in Text Mining only
Mucinous Adenocarcinoma	Mucinous Adenocarcinoma	LHGDN	16142311		★☆☆☆☆ Found in Text Mining only
Mucoepidermoid Carcinoma	Mucoepidermoid Carcinoma	BEFREE	17315172, 31563905		★☆☆☆☆ Found in Text Mining only
Multiple Endocrine Neoplasia Type 1	Multiple Endocrine Neoplasia	BEFREE	11756777		★☆☆☆☆ Found in Text Mining only
Multiple lipomata	Multiple Lipomata	HPO_DG			★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	27655696, 30802944		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	27655696, 35389550	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	24810631, 31238945, 31408242		★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Duchenne	Duchenne Muscular Dystrophy	BEFREE	12524552, 24233542		★☆☆☆☆ Found in Text Mining only
MUTYH-Associate Polyposis	Polyposis	BEFREE	14999774, 15788729, 16510566, 17039270, 17505512, 17524638, 19013464, 19414146, 19593690, 19931546, 27705013, 30836352, 31527860		★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	20197553, 24674452		★☆☆☆☆ Found in Text Mining only
Myeloproliferative Disorders	Myeloproliferative disorder	Pubtator	12555209	Associate	★☆☆☆☆ Found in Text Mining only
MYELOPROLIFERATIVE SYNDROME, TRANSIENT	Myeloproliferative disorder	BEFREE	27015438		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	15131548, 18757851, 26936869, 3590079, 8589213, 8678388, 8772620		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	33380594	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	BEFREE	30974752		★☆☆☆☆ Found in Text Mining only
Myocarditis	Myocarditis	BEFREE	29212909		★☆☆☆☆ Found in Text Mining only
Myxoid/Round Cell Liposarcoma	Myxoid Liposarcoma	BEFREE	16858687		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	20473931, 28004426, 28543390		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	20473931, 27769064	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Neoplasms	Nasopharyngeal carcinoma	Pubtator	8224661	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10090483, 10090594, 10188731, 10197610, 10344733, 10367940, 10398436, 10470088, 10489374, 10490837, 10493496, 10517975, 10539901, 10544223, 10549031, 10562580, 10595736, 10595907, 10630180, 10664249, 10668484, 10674823, 10705390, 10737725, 10737795, 10763829, 10834386, 10911903, 10911904, 10945171, 10959075, 10969779, 10972292, 11067897, 11112217, 11196455, 11237529, 11260864, 11289147, 11309340, 11338478, 11382316, 11429699, 11437404, 11439330, 11440966, 11448917, 11454429, 11474297, 11598481, 11737884, 11756228, 11756777, 11809682, 11809809, 11819789, 11896079, 11920497, 11956582, 11987262, 12111368, 12154064, 12185585, 12198712, 12210511, 12378616, 12429618, 12439747, 12455028, 12480914, 12502211, 12533824, 12571275, 12606944, 12663519, 12701683, 12774245, 12901725, 1310068, 1316610, 1324739, 1338760, 1338904, 1347643, 1351034, 14527906, 14578138, 14633673, 14702190, 14706618, 15034862, 15041703, 15073103, 15083323, 15107603, 15131404, 15153437, 15153546, 15185002, 15197775, 15235020, 15245581, 15256053, 1528264, 15326380, 15459959, 15467712, 15488641, 15507235, 15508191, 15513360, 15555207, 15570044, 15623627, 15640937, 1565631, 15687890, 15733272, 15754020, 15796198, 15802015, 15987719, 16043258, 16075282, 16110024, 16170165, 16184469, 16317745, 16356174, 16426911, 16450383, 16537703, 16645205, 1670965, 16760136, 16804962, 16815967, 16820884, 16855398, 16867867, 16897741, 16902913, 16998673, 17047077, 17065059, 17085661, 17135276, 17160019, 17251345, 17257127, 17278096, 17293347, 17301249, 17382967, 17565744, 17570218, 17653897, 17881494, 17908962, 18000373, 18058533, 18160396, 18211945, 18224684, 18241037, 18337602, 18471519, 18474248, 18498268, 18542073, 18549879, 18632876, 18662704, 18704758, 18708403, 18977219, 18992635, 18996677, 19116878, 19123982, 19149902, 19259700, 19307944, 19474113, 19527492, 19701947, 19789364, 19826416, 19829046, 20007506, 20010873, 20091866, 20208994, 20232483, 20417090, 20532534, 20544848, 20640893, 20707908, 20824703, 20841474, 20978149, 21090969, 21134075, 21225233, 21241890, 21255913, 21383541, 21518821, 21532750, 21533174, 21599969, 21600201, 21649465, 21769429, 21807601, 21830905, 21837511, 21885812, 21937258, 22068457, 22081130, 22129206, 22207181, 22266195, 22287596, 22308460, 22395475, 22695536, 22847197, 22899370, 23099886, 23219837, 23302090, 23318418, 23320800, 23376149, 23428864, 23520519, 23539443, 23702823, 23799088, 23846443, 23873622, 23906606, 24104354, 24293293, 24416237, 24500912, 24599579, 24623448, 24667635, 24699064, 24804778, 24840027, 24887488, 25051912, 25074465, 25107489, 25285168, 25320087, 25344691, 25417611, 25496852, 25514805, 25574089, 25607840, 25676610, 25683705, 25716913, 25913740, 26018692, 26070193, 26171757, 26186212, 26189482, 26216840, 26305864, 26329581, 26407953, 26436499, 26455319, 26681652, 26723934, 26877610, 27190263, 27217144, 27270652, 27302369, 27374082, 27398792, 27494112, 27706614, 27799065, 27852897, 27890529, 27939883, 27983523, 27984236, 28057861, 28099595, 28105931, 28134256, 28137366, 28145797, 28222664, 28222775, 28271271, 28350521, 28403857, 28418886, 28576136, 28622887, 28652417, 28730258, 28791728, 28988820, 28994108, 29079964, 29086431, 29147609, 29148535, 29199019, 29327707, 29334915, 29440928, 29518763, 29525853, 29641560, 29652833, 29758216, 29951927, 29964340, 30131849, 30172912, 30257383, 30334948, 30396569, 30523493, 30760720, 30799131, 30811747, 30868894, 30887153, 30927944, 31036696, 31160382, 31278963, 31441682, 31492840, 31512030, 31540078, 31631067, 31653819, 31712236, 7478622, 7513541, 7585543, 7606712, 7796415, 7798298, 7803543, 7835579, 7851569, 7882361, 7923210, 7927873, 7958689, 7962323, 7981058, 8055154, 8111410, 8118796, 8168108, 8226275, 8242071, 8318422, 8381581, 8388766, 8393050, 8402727, 8406987, 8484121, 8536888, 8594558, 8608492, 8608553, 8616874, 8632608, 8672984, 8724537, 8741802, 8829653, 8834768, 8862382, 8895682, 8943812, 8960890, 8980382, 9020916, 9024698, 9083931, 9143408, 9176082, 9196441, 9207270, 9218594, 9274521, 9307185, 9378549, 9385369, 9399850, 9438104, 9450908, 9454883, 9508117, 9585611, 9591632, 9602705, 9621517, 9663597, 9666806, 9708792, 9731533, 9744312, 9751605, 9823979, 9973276, 9990480		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	CLINVAR_DG	25157968		★☆☆☆☆ Found in Text Mining only
Neoplastic Syndromes, Hereditary	Hereditary Cancer Syndrome	CLINVAR_DG	10077047, 10083733, 10090483, 10094547, 10440612, 10598803, 10646887, 10656683, 10768871, 10811618, 10938175, 10951583, 10982189, 11001924, 11159880, 11247896, 11707392, 11768389, 11839722, 11933206, 11960572, 12007223, 12010888, 12173026, 12357334, 12581900, 12702169, 12901799, 1316610, 1324223, 1338764, 14729851, 14961559, 15024739, 15108286, 15300853, 15459959, 15771908, 15833136, 15857185, 15951963, 16088911, 16134147, 16228836, 16317745, 1651563, 16883523, 17135276, 17230660, 17411426, 17486639, 17489848, 17604324, 17963004, 18063416, 18166348, 18199528, 18343606, 18387968, 18433509, 18629394, 19029688, 19036155, 19196998, 19331226, 19336753, 19444466, 19531215, 19768578, 19793053, 19828935, 20033787, 20223039, 20333795, 20434453, 20649969, 20682701, 20685668, 20924072, 21078199, 21110124, 21142386, 21653199, 21779980, 21858148, 21859464, 22135120, 22150579, 22658618, 22809634, 22941256, 22987206, 23159591, 23185543, 23244118, 23460355, 23561487, 23575299, 23576677, 23715166, 23896379, 23906606, 24518971, 24599579, 24664542, 24728327, 24735542, 24750145, 25123297, 25208568, 25525159, 25590978, 25832318, 25980754, 26023681, 26300997, 26314409, 26421687, 26422110, 26446593, 26613750, 26625971, 26681312, 26840078, 27000756, 27081525, 27146957, 27153395, 27158207, 27574554, 28125075, 28135145, 28185118, 28533537, 7833149, 7833936, 7853377, 8103406, 8118461, 8162022, 8187091, 8252630, 8381579, 8381580, 8395941, 8544194, 8730280, 8844222, 8968744, 8990002, 9101302, 9288102, 9341879, 9375853, 9521420, 9585611, 9824584, 9950360, 9973276		★☆☆☆☆ Found in Text Mining only
Neoplastic Syndromes, Hereditary	Hereditary Cancer Syndrome	BEFREE	8537055		★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	15623481, 22081130, 7513541, 8741802		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	17570703, 9220497		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	31026621, 32923630	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	19302148, 28505105, 31785347		★☆☆☆☆ Found in Text Mining only
Neurodevelopmental Disorders	Neurodevelopmental Disorders	BEFREE	30395321		★☆☆☆☆ Found in Text Mining only
Neuroectodermal Tumor, Primitive	Neuroectodermal Tumors	BEFREE	11433413		★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	26434631		★☆☆☆☆ Found in Text Mining only
Neurofibromatoses	Neurofibromatosis	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Neutrophilia (disorder)	Neutrophilia	BEFREE	14662873		★☆☆☆☆ Found in Text Mining only
Niemann-Pick Disease, Type C	Niemann-Pick Disease	BEFREE	28543390		★☆☆☆☆ Found in Text Mining only
NON RARE IN EUROPE: Non rare thrombophilia	Non Rare Thrombophilia	Orphanet			★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	31514003		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	10549031, 11429699, 11448917, 11895880, 12455028, 12841866, 1348017, 18337602, 21255913, 22542170, 24860162, 25607840, 26119430, 26681652, 28497891, 29362846, 30237512, 7923210		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	CTD_human_DG	18337602		★☆☆☆☆ Found in Text Mining only
Nystagmus	Nystagmus	HPO_DG			★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	10404768, 25420728, 26945992, 29533795, 30259314, 30735960		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	26945992, 35163195	Associate	★☆☆☆☆ Found in Text Mining only
Obesity Morbid	Obesity	Pubtator	29457027	Associate	★☆☆☆☆ Found in Text Mining only
Odontogenic Tumors	Odontogenic Tumor	BEFREE	18486530		★☆☆☆☆ Found in Text Mining only
Odontoma	Odontoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Oligodendroglioma	Oligodendroglioma	Pubtator	36662405	Associate	★☆☆☆☆ Found in Text Mining only
oligodendroglioma	Oligodendroglioma	BEFREE	7515658		★☆☆☆☆ Found in Text Mining only
Optic Neuropathy Ischemic	Optic neuropathy	Pubtator	15043529	Associate	★☆☆☆☆ Found in Text Mining only
Oral Submucous Fibrosis	Oral submucous fibrosis	Pubtator	38050610	Associate	★☆☆☆☆ Found in Text Mining only
Osteoma	Osteoma	BEFREE	15095859, 16411234, 27291484		★☆☆☆☆ Found in Text Mining only
Osteoma	Osteoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	17786187	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	24840027, 30420287, 31396323		★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	8019564		★☆☆☆☆ Found in Text Mining only
Ovarian Hyperstimulation Syndrome	Ovarian Hyperstimulation Syndrome	BEFREE	16434147		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	24078348, 24761891, 25545608, 29921377, 31737207, 8019564, 9679945		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	24078348, 29793804, 33177242, 33560870, 33571724, 34609082	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	26082331	Stimulate	★☆☆☆☆ Found in Text Mining only
Ovarian Serous Adenocarcinoma	Ovarian serous adenocarcinoma	BEFREE	26232338		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	1423316, 15264268, 19023234, 19150414, 22110720, 27838800, 31391772, 31540078, 8406987		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	CGI_DG			★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma familial	Pancreatic cancer	Pubtator	12173321	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	24293293, 30368889		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	11756777, 24293293, 27838800		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	HPO_DG			★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	CGI_DG			★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	11943721, 20056645, 24293293, 24534469, 25479140, 26394139, 29961768, 30811747, 32113160, 35205366, 36629695, 36896836	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	LHGDN	16420659		★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	Pubtator	16420659	Associate	★☆☆☆☆ Found in Text Mining only
Papillary adenoma	Papillary Adenoma	CTD_human_DG	10383901, 12034317, 19092804, 30188895, 9111214		★☆☆☆☆ Found in Text Mining only
Papillary Renal Cell Carcinoma	Papillary Renal Carcinoma	BEFREE	20553257		★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	10634400, 11293895, 15095272, 15205109, 16680592, 18024325, 20935450, 30990120, 31598872, 7946597, 9506763, 9841749		★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Papilledema	Papilledema	HPO_DG			★☆☆☆☆ Found in Text Mining only
Parathyroid Gland Adenocarcinoma	Parathyroid Gland Adenocarcinoma	BEFREE	27071708		★☆☆☆☆ Found in Text Mining only
Parathyroid Neoplasms	Parathyroid Neoplasms	BEFREE	11756777, 22395475		★☆☆☆☆ Found in Text Mining only
Parathyroid Neoplasms	Parathyroid neoplasm	Pubtator	20208994, 21078161	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	25061051, 30236122		★☆☆☆☆ Found in Text Mining only
Peptic Esophagitis	Peptic Esophagitis	BEFREE	11016622		★☆☆☆☆ Found in Text Mining only
Peripheral Vascular Diseases	Vascular Diseases	BEFREE	9786256		★☆☆☆☆ Found in Text Mining only
Peripheral Vascular Diseases	Peripheral vascular disease	Pubtator	9786256	Associate	★☆☆☆☆ Found in Text Mining only
Peritonitis	Peritonitis	Pubtator	32166754	Associate	★☆☆☆☆ Found in Text Mining only
Pervasive Development Disorder	Autism spectrum disorder	BEFREE	17221838		★☆☆☆☆ Found in Text Mining only
Peutz-Jeghers Syndrome	Peutz-Jeghers Syndrome	BEFREE	11215281, 30807303		★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	BEFREE	15796198		★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	Pubtator	15796198	Associate	★☆☆☆☆ Found in Text Mining only
Pilomatrixoma	Pilomatrixoma	BEFREE	12575848, 16378715		★☆☆☆☆ Found in Text Mining only
Pilomatrixoma	Pilomatrixoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Pituitary Adenoma	Pituitary adenoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Pleocytosis	CSF pleocytosis	CTD_human_DG	27725143		★☆☆☆☆ Found in Text Mining only
Polycystic Kidney Diseases	Polycystic kidney disease	BEFREE	12524552		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	11119756		★☆☆☆☆ Found in Text Mining only
Polyendocrinopathies, Autoimmune	Autoimmune Polyendocrinopathy	BEFREE	22290026, 8735142		★☆☆☆☆ Found in Text Mining only
Polymyositis	Polymyositis	BEFREE	29303701		★☆☆☆☆ Found in Text Mining only
Polyp of large intestine	Polyp Of Large Intestine	BEFREE	10188731, 10665844, 10938175, 1319838, 16478792, 19169759, 21865138, 25820106, 30904095, 8835324, 8968744, 9809998, 9973276		★☆☆☆☆ Found in Text Mining only
Polyposis, Adenomatous Intestinal	Multiple polyposis syndrome	CLINVAR_DG	10077047, 10083733, 10090483, 10094547, 10470088, 10612827, 10646887, 10713886, 10768871, 10923044, 10982189, 11001924, 11247896, 11317365, 11748858, 11768389, 11839722, 11933206, 11960572, 12007223, 12010888, 12034871, 12173026, 12357334, 12486240, 12702169, 1316610, 1324223, 1338764, 14522379, 14961559, 15024739, 15108286, 15108288, 15131404, 15300576, 15300853, 15311282, 15459959, 15712637, 15771908, 15833136, 15951963, 16088911, 16134147, 16317745, 16461775, 1651563, 16680592, 16736293, 17064931, 17293347, 17411426, 17426470, 17489848, 17604324, 17854661, 17963004, 18063416, 18199528, 18224684, 18343606, 1843350, 18433509, 18629394, 18794146, 19029688, 19036155, 19196998, 19444466, 1944466, 19531215, 19725996, 19793053, 20033787, 20223039, 20333795, 20434453, 20513532, 20564245, 20649969, 20685668, 2068568, 20924072, 21110124, 21520333, 21643010, 21646762, 21779980, 22135120, 22150579, 22164339, 22431159, 22703879, 22987206, 23085758, 23159591, 23244118, 23460355, 23561487, 23575299, 23576677, 23715166, 23896379, 24310308, 24416237, 24506336, 24518971, 24549056, 24599579, 24664542, 24728327, 24735542, 25317407, 25559809, 25590978, 25604157, 25980754, 26300997, 26309368, 26414517, 26446593, 26613750, 26681312, 27081525, 27087319, 27158207, 27343414, 27623068, 28127413, 28533537, 28944238, 7746201, 7959691, 8103406, 8111416, 8118461, 8125478, 8162022, 8162051, 8187091, 8252630, 8381579, 8381580, 8381581, 8395941, 8594558, 8730280, 8844222, 8940264, 8956059, 8990002, 9067764, 9101302, 9288102, 9375853, 9452101, 9487968, 9585611, 9724771, 9751605, 9824584, 9950360		★☆☆☆☆ Found in Text Mining only
Polyposis, Adenomatous Intestinal	Multiple polyposis syndrome	CTD_human_DG	11040535, 11420398, 11588890, 11766074, 12394442, 17942926, 18704758, 25200834, 25280562, 28414304, 8071957		★☆☆☆☆ Found in Text Mining only
Polyposis, Gastric	Gastric polyposis	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Polyposis, Gastric	Gastric polyposis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Portal Vein Thrombosis	Portal Vein Thrombosis	BEFREE	16493481, 23428864		★☆☆☆☆ Found in Text Mining only
Primary Ciliary Dyskinesia	Ciliary dyskinesia	BEFREE	30883460		★☆☆☆☆ Found in Text Mining only
Profound Mental Retardation	Mental retardation	CTD_human_DG	8071957		★☆☆☆☆ Found in Text Mining only
Proliferative vitreoretinopathy	Proliferative Vitreoretinopathy	BEFREE	15218453		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	12856637, 15623627, 15930345, 16170165, 16446401, 16537703, 16956712, 17947477, 18242387, 21207416, 21944123, 22999998, 23299921, 24651255, 26860439, 29660369, 30373654, 31165705, 31646760, 7928631, 8609698, 9690990		★☆☆☆☆ Found in Text Mining only
Prostatic Intraepithelial Neoplasia	Prostatic intraepithelial neoplasia	Pubtator	16446401	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	16446401, 21694441, 21830905, 22672250, 24651255, 24769028, 26860439, 27898031, 29660369, 30339521, 30373654, 31115550, 31134918, 31605802, 34581895, 35131873, 35347810, 36922933	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	17363566, 29610475		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	17947477, 17960617		★☆☆☆☆ Found in Text Mining only
Protein C Deficiency	Protein C Deficiency	BEFREE	10942114, 10997987, 14707707, 15114590, 19141162, 22441373, 28294177, 31821907, 6238642, 7841323, 7865674, 8163684, 8398833, 8499568, 8607097, 8822578, 8845458, 8943855, 9788727		★☆☆☆☆ Found in Text Mining only
Protein C Deficiency	Protein C Deficiency	LHGDN	12482406, 15114590, 18376272, 18573519, 19190829		★☆☆☆☆ Found in Text Mining only
Protein C Deficiency	Protein C Deficiency	CTD_human_DG	14707701, 18376272, 21445774		★☆☆☆☆ Found in Text Mining only
Protein C Deficiency	Protein C Deficiency	ORPHANET_DG	23521084		★☆☆☆☆ Found in Text Mining only
Protein C Deficiency	Protein C Deficiency	CLINVAR_DG	31064749		★☆☆☆☆ Found in Text Mining only
Protein C Deficiency	Protein C Deficiency	GENOMICS_ENGLAND_DG			★☆☆☆☆ Found in Text Mining only
Protein C Deficiency	Protein C Deficiency	HPO_DG			★☆☆☆☆ Found in Text Mining only
Protein S Deficiency	Protein S Deficiency	BEFREE	15713144, 3161207, 8298131, 8774498, 8815575		★☆☆☆☆ Found in Text Mining only
Ptosis	Ptosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	21624643, 35438040	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	30350313	Inhibit	★☆☆☆☆ Found in Text Mining only
Pulmonary Thromboembolisms	Pulmonary thromboembolism	BEFREE	10442401, 8732627		★☆☆☆☆ Found in Text Mining only
Purpura Fulminans	Purpura Fulminans	BEFREE	10997987, 14707707, 1503096, 24158118, 26250584, 27138381, 28111891, 29356699, 29630665, 29683961, 30702334, 30835920, 31521534, 7841323		★☆☆☆☆ Found in Text Mining only
Purpura Fulminans	Purpura Fulminans	CTD_human_DG	18376272		★☆☆☆☆ Found in Text Mining only
Pyruvate Carboxylase Deficiency Disease	Pyruvate Carboxylase Deficiency Disease	BEFREE	10669160, 11438441, 12437512, 12663483, 1301959, 1503096, 15449030, 15706477, 19133979, 19306334, 22168450, 22531345, 22545135, 22576310, 22984498, 23379934, 2402741, 25533856, 25618265, 26134363, 27138381, 27517348, 29683961, 3101494, 31254973, 3590079, 6883708, 7740502, 7742536, 7918683, 8018768, 8322701, 8704244, 9271815, 9763348		★☆☆☆☆ Found in Text Mining only
Pyruvate Carboxylase Deficiency Disease	Pyruvate Carboxylase Deficiency Disease	CLINVAR_DG	12112657, 18676167, 19306334, 23430542, 25058219		★☆☆☆☆ Found in Text Mining only
Pyruvate Carboxylase Deficiency Disease	Pyruvate Carboxylase Deficiency Disease	GENOMICS_ENGLAND_DG	19306334, 27604308		★☆☆☆☆ Found in Text Mining only
Pyruvate Carboxylase Deficiency Disease	Pyruvate Carboxylase Deficiency Disease	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Pyruvate carboxylase deficiency, benign type	Pyruvate Carboxylase Deficiency Disease	Orphanet			★☆☆☆☆ Found in Text Mining only
Pyruvate carboxylase deficiency, infantile type	Pyruvate Carboxylase Deficiency Disease	Orphanet			★☆☆☆☆ Found in Text Mining only
Pyruvate carboxylase deficiency, severe neonatal type	Pyruvate Carboxylase Deficiency Disease	Orphanet			★☆☆☆☆ Found in Text Mining only
Radioulnar Synostosis	Radioulnar Synostosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Rectal Carcinoma	Rectal Carcinoma	BEFREE	11592095, 16184469, 17116713, 19304403, 23534709, 25025473, 30577807		★☆☆☆☆ Found in Text Mining only
Rectal Carcinoma	Rectal Carcinoma	CTD_human_DG	11766074, 8071957		★☆☆☆☆ Found in Text Mining only
Rectal Neoplasms	Rectal Neoplasms	BEFREE	10674823		★☆☆☆☆ Found in Text Mining only
Rectal Neoplasms	Rectal Neoplasms	CTD_human_DG	11766074, 8071957		★☆☆☆☆ Found in Text Mining only
Rectal Neoplasms	Rectal Neoplasms	LHGDN	16184469		★☆☆☆☆ Found in Text Mining only
Rectal polyp	Rectal Polyp	BEFREE	20229069		★☆☆☆☆ Found in Text Mining only
Refractory anemias	Anemia	BEFREE	22019586		★☆☆☆☆ Found in Text Mining only
Relative macrocephaly	Macrocephaly	HPO_DG			★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	10426194, 15203750		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Renal dysplasia	Renal dysplasia	BEFREE	28551651		★☆☆☆☆ Found in Text Mining only
Renal Tubular Acidosis, Type II	Renal Tubular Acidosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Renal tubular disorder	Renal Tubular Disorder	BEFREE	27052416		★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	CTD_human_DG	25070658		★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	BEFREE	29264361		★☆☆☆☆ Found in Text Mining only
Respiratory Tract Infections	Respiratory system infectious disease	Pubtator	12057910	Associate	★☆☆☆☆ Found in Text Mining only
Retinal Detachment	Retinal detachment	Pubtator	34654403	Inhibit	★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal detachment	Pubtator	7485167, 8733048	Associate	★☆☆☆☆ Found in Text Mining only
Retinal Vein Occlusion	Retinal Vein Occlusion	BEFREE	18449423		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	15041703, 29856829, 8741802, 9220497		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	36342106	Associate	★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	10553089, 11290778, 12444176, 22019586, 29303701, 30649471		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	LHGDN	15248212		★☆☆☆☆ Found in Text Mining only
Rothmund-Thomson syndrome	Rothmund-Thomson Syndrome	BEFREE	31303264		★☆☆☆☆ Found in Text Mining only
Salivary Gland Neoplasms	Salivary gland neoplasms	Pubtator	20520817	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	Pubtator	3371278	Stimulate	★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	11920741, 7478622		★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	31702654	Associate	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	LHGDN	15768050		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	PSYGENET_DG	15768050		★☆☆☆☆ Found in Text Mining only
Scoliosis, unspecified	Scoliosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Seborrheic keratosis	Seborrheic keratosis	BEFREE	15287021		★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	BEFREE	20092957		★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	Pubtator	22068818	Associate	★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	11496851, 15710622	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sepsis	Sepsis	Pubtator	17255099	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Septicemia	Septicemia	BEFREE	10930989, 11278252, 12869495, 17569089, 18174455, 18579691, 19279234, 19350118, 19466992, 19548065, 19630784, 19995397, 22608565, 24177324, 25032959, 25860876, 26436558, 27836986, 28408624, 29343482, 30974752, 31256946, 31612119, 31689983		★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	CTD_human_DG	11820775, 17556722		★☆☆☆☆ Found in Text Mining only
Severe hereditary thrombophilia due to congenital protein C deficiency	Hereditary Thrombophilia	Orphanet			★☆☆☆☆ Found in Text Mining only
Sicca Syndrome	Sjogren`s Syndrome	BEFREE	9332318		★☆☆☆☆ Found in Text Mining only
Sick Sinus Syndrome	Sick sinus syndrome	Pubtator	22986510	Stimulate	★☆☆☆☆ Found in Text Mining only
Sinus Thrombosis, Intracranial	Sinus Thrombosis, Intracranial	BEFREE	27314862		★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	10997987, 14707707		★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin Neoplasms	BEFREE	10674823		★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin Neoplasms	HPO_DG			★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	11895880, 1348017, 15146565, 30224629, 8402711		★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	30224629, 33880365	Associate	★☆☆☆☆ Found in Text Mining only
Small intestine carcinoid	Intestinal carcinoid	HPO_DG			★☆☆☆☆ Found in Text Mining only
Soft Tissue Neoplasms	Soft Tissue Neoplasms	BEFREE	10834386, 18715618, 30919136		★☆☆☆☆ Found in Text Mining only
Soft Tissue Neoplasms	Soft Tissue Neoplasms	HPO_DG			★☆☆☆☆ Found in Text Mining only
Sporadic Breast Carcinoma	Breast Carcinoma	BEFREE	27983523		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	10970088, 11180160, 11448914, 12841866, 15641992, 16259108, 18617334, 21518821, 22542170, 26319365, 26862903, 27494112, 7522040, 7927873, 7958689, 8137268, 8943812		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	15754020, 16426911, 18617334		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	15488641, 16426911, 19149902		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	20537188, 25147921, 27706614, 32113465	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	GWASCAT_DG	29924316		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	27706614, 30624179		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	10485468, 10605402, 11891177, 12373147, 12378616, 12695555, 12746473, 1317264, 20025482, 23049225, 24197976, 25210923, 26033320, 26073472, 28543390, 28617917, 30376837, 30474112, 8226275, 8406987, 9990480		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	CGI_DG			★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Stomach disease	Pubtator	15494708, 15962383, 25210923	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	10605402, 12378616, 15942635, 15962383, 20205286, 20978327, 23049225, 23131390, 24197976, 24861525, 25210923, 25656989, 27566570, 28039579, 28076475, 28576136, 30376837, 32533343, 33525650, 36244328, 37591783, 8226275	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	BEFREE	18224684, 31411765, 8259518, 8649856		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	30593147	Inhibit	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	HPO_DG			★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	CGI_DG			★☆☆☆☆ Found in Text Mining only
Stomatitis	Stomatitis	Pubtator	27769064	Associate	★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	15574195, 19691480, 31271700	Associate	★☆☆☆☆ Found in Text Mining only
Superficial Thrombophlebitis	Superficial Thrombophlebitis	BEFREE	8640401		★☆☆☆☆ Found in Text Mining only
Superficial Thrombophlebitis	Superficial Thrombophlebitis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Supraventricular tachycardia	Supraventricular tachycardia	BEFREE	9576081		★☆☆☆☆ Found in Text Mining only
Sweet Syndrome	Sweet Syndrome	BEFREE	9332318		★☆☆☆☆ Found in Text Mining only
Syndactyly Cenani Lenz type	Syndactyly	BEFREE	25676610		★☆☆☆☆ Found in Text Mining only
Syndactyly Cenani Lenz type	Syndactyly	ORPHANET_DG	25676610		★☆☆☆☆ Found in Text Mining only
Syndactyly of fingers	Syndactyly of fingers	HPO_DG			★☆☆☆☆ Found in Text Mining only
Syndactyly of the toes	Syndactyly Of The Toes	HPO_DG			★☆☆☆☆ Found in Text Mining only
synovial sarcoma	Synovial sarcoma	BEFREE	11920741, 9332318		★☆☆☆☆ Found in Text Mining only
Testicular Neoplasms	Testicular neoplasm	Pubtator	22068818	Associate	★☆☆☆☆ Found in Text Mining only
Thrombocythemia, Essential	Thrombocythemia	BEFREE	12772054		★☆☆☆☆ Found in Text Mining only
Thromboembolism	Thromboembolism	Pubtator	14675088, 23986205, 28511552, 28607330, 33619677, 7811989, 9610620, 9683579	Associate	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Thrombophilia	Thrombophilia	BEFREE	10378363, 10468797, 10492912, 10650856, 10874575, 11342806, 11686318, 11776306, 11914653, 12221665, 15562039, 16496494, 16497622, 18854273, 20214832, 20378562, 20421270, 22398278, 22627591, 23301217, 26008227, 26315791, 27090446, 27314862, 27421039, 28063132, 28111891, 29063359, 29097362, 29285085, 29374276, 29747524, 29782332, 30210609, 30384036, 30485173, 30702334, 31295762, 31821907, 7590506, 7632412, 7902898, 7911873, 7986734, 8180338, 8578447, 8603014, 8607109, 8624369, 8637344, 8701918, 8725708, 8772620, 8815575, 8839395, 8872815, 8873345, 8943855, 8970058, 9046944, 9107093, 9198201, 9241706, 9241707, 9271815, 9372020, 9382368, 9383024, 9499670, 9530303, 9625586, 9648899, 9763354, 9841693		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thrombophilia	Thrombophilia	Pubtator	12221665, 12492586, 12518722, 16245227, 17456626, 19117968, 19903694, 20002000, 20935614, 21511556, 21869933, 23406614, 23945127, 29374276, 29747524, 30637129, 35112923, 36356579, 36560757, 8049422, 9108399	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thrombophilia	Thrombophilia	LHGDN	12482406		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thrombophilia	Thrombophilia	HPO_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thrombophilia due to Activated Protein C Resistance	Thrombophilia	Pubtator	20501981	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
THROMBOPHILIA DUE TO ACTIVATED PROTEIN C RESISTANCE (disorder)	Activated Protein C Resistance	BEFREE	10368524, 29294595, 7493138		★☆☆☆☆ Found in Text Mining only
THROMBOPHILIA DUE TO PROTEIN C DEFICIENCY, AUTOSOMAL RECESSIVE	Thrombophilia	UNIPROT_DG	1511988, 1593215, 1611081, 25618265, 7841323, 7841324, 7878626		★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
THROMBOPHILIA DUE TO PROTEIN C DEFICIENCY, AUTOSOMAL RECESSIVE	Thrombophilia	CLINVAR_DG			★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
THROMBOPHILIA DUE TO PROTEIN C DEFICIENCY, AUTOSOMAL RECESSIVE	Thrombophilia	CTD_human_DG			★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
THROMBOPHILIA DUE TO PROTEIN C DEFICIENCY, AUTOSOMAL RECESSIVE	Thrombophilia	GENOMICS_ENGLAND_DG			★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Thrombophilia hereditary	Thrombophilia	Pubtator	2437584, 31490209, 9746774	Associate	★☆☆☆☆ Found in Text Mining only
Thrombophilia, hereditary	Thrombophilia	BEFREE	26492443, 28804825, 8704244, 8815576, 9136971, 9535390		★☆☆☆☆ Found in Text Mining only
Thrombophilia, Hereditary, Due To Protein C Deficiency, Autosomal Dominant	Thrombophilia	CLINVAR_DG	10942114, 1301959, 1347608, 14642106, 1464619, 1498334, 1511989, 1593215, 15978566, 16867987, 17152060, 17635713, 1771629, 1868249, 18954896, 19822351, 22545135, 22817391, 23332921, 24028705, 24162787, 27172833, 28111891, 28468828, 7482420, 7605880, 7792728, 8446940, 8477066, 8499565, 8499568, 8505327, 8807339, 9798967, 9840027		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thrombophilia, Hereditary, Due To Protein C Deficiency, Autosomal Dominant	Thrombophilia	UNIPROT_DG	1301959, 1347706, 1511989, 1868249, 2437584, 25618265, 25748729, 2602169, 7792728, 7865674, 8292730, 8398832, 8499568, 8560401, 8829639, 9798967		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thrombophilia, Hereditary, Due To Protein C Deficiency, Autosomal Dominant	Thrombophilia	GENOMICS_ENGLAND_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thrombosis	Thrombosis	Pubtator	10419879, 10519989, 11456407, 11496851, 12010798, 14976057, 15114590, 15574195, 16138341, 16270394, 1661291, 17456626, 17677000, 18160601, 19133979, 21511556, 23389250, 24723678, 24758255, 24782131, 25196808, 2602169, 26181660, 26699866, 27172833, 28405673, 31092765, 31399531, 32781781, 34654403, 35627118, 36012233, 7780127, 7961868, 8034625, 8049422, 8164741, 8324221, 8611698, 8704244, 9067500, 9183305, 9406051, 9454742, 9610620, 9746774, 9949170	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thrombosis	Thrombosis	Pubtator	31314700	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thrombosis of cerebral veins	Thrombosis	BEFREE	9553844		★☆☆☆☆ Found in Text Mining only
Thrombosis of cerebral veins	Thrombosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Thyroid cancer medullary	Medullary thyroid cancer	Pubtator	29518763	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	10363573, 31758407, 32024448	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid cancer, follicular	Thyroid cancer	BEFREE	23604857		★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	10363573, 10634400, 11092973, 11106555, 11293895, 12701683, 19036155, 19564752, 28410400, 7962323, 7981058, 9916927		★☆☆☆☆ Found in Text Mining only
Thyroid Diseases	Thyroid Diseases	BEFREE	20935450		★☆☆☆☆ Found in Text Mining only
Thyroid Gland Follicular Adenoma	Thyroid Gland Follicular Adenoma	BEFREE	7962323		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	LHGDN	14574158, 16680592		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	19036155, 19564752, 28410400, 7962323, 7981058, 9916927		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	10363573, 11092973, 28410400, 32024448, 38165228, 9916927	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Nodule	Thyroid Nodule	HPO_DG			★☆☆☆☆ Found in Text Mining only
Tomaculous neuropathy	Hereditary neuropathy with liability to pressure palsies	Pubtator	1569192, 8798478	Associate	★☆☆☆☆ Found in Text Mining only
Toxic Epidermal Necrolysis	Stevens-Johnson Syndrome	BEFREE	17973119		★☆☆☆☆ Found in Text Mining only
Transient Ischemic Attack	Transient Ischemic Attack	BEFREE	9555645		★☆☆☆☆ Found in Text Mining only
Transitional cell carcinoma of bladder	Bladder carcinoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Trichohepatoenteric Syndrome	Trichohepatoenteric Syndrome	BEFREE	16134147, 30585891		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	30624764		★☆☆☆☆ Found in Text Mining only
Tumors of Adrenal Cortex	Tumors Of Adrenal Cortex	BEFREE	9496836		★☆☆☆☆ Found in Text Mining only
Turcot syndrome	Turcot syndrome	Pubtator	10666372, 27978560, 28548127, 32620917, 33279946, 36360190, 7661930, 9508117	Associate	★☆☆☆☆ Found in Text Mining only
Turcot syndrome (disorder)	Turcot syndrome	BEFREE	10759189, 12555076, 15077159, 19755659, 20141232, 24309598, 27143045, 29424427, 7515658, 8593545		★☆☆☆☆ Found in Text Mining only
Turcot syndrome (disorder)	Turcot syndrome	CTD_human_DG	7661930		★☆☆☆☆ Found in Text Mining only
Turcot syndrome with polyposis	Turcot Syndrome With Polyposis	Orphanet			★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	10595736, 11920497, 27063727, 27153478, 9433483, 9490271		★☆☆☆☆ Found in Text Mining only
Uremia	Uremia	LHGDN	16105054		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	17404085, 21599969, 30064409, 40603329, 7669581	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Anomalies	Uterine Anomalies	BEFREE	31010347		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	26643927, 32533343	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	17242701	Inhibit	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	20208141, 29079964, 29115417	Associate	★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal Melanoma	BEFREE	18211945		★☆☆☆☆ Found in Text Mining only
Uveitis, Posterior	Uveitis	BEFREE	21851971		★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	10847236, 31412739		★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	32382091	Inhibit	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	34873055	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Malformation Primary Intraosseous	Vascular malformation	Pubtator	32113465	Associate	★☆☆☆☆ Found in Text Mining only
Vascular System Injuries	Vascular system injury	Pubtator	17170365	Associate	★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	Pubtator	30352204	Associate	★☆☆☆☆ Found in Text Mining only
VATER association	Vacterl association	Pubtator	36243179	Associate	★☆☆☆☆ Found in Text Mining only
Venous Insufficiency	Venous Insufficiency	HPO_DG			★☆☆☆☆ Found in Text Mining only
Venous Thromboembolism	Venous thromboembolism	Pubtator	10444192, 11697723, 12239149, 12570104, 12884202, 15842356, 20802025, 22044617, 22581447, 22812604, 23986205, 24051141, 25196808, 25472531, 25651845, 26304686, 28511552, 31314700, 31875702, 39846164, 8704244, 9269773, 9683579, 9698021	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Venous Thromboembolism	Venous thromboembolism	Pubtator	15257714, 32781781	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Venous Thrombosis	Venous thrombosis	Pubtator	10419879, 11380450, 12884202, 14675088, 14976057, 15114590, 15140118, 15304035, 15815078, 15978099, 16359508, 16917913, 17107352, 17461930, 18160601, 20699261, 22443383, 22545135, 24951429, 25196808, 25306186, 27090446, 28405673, 29851809, 31399531, 31875702, 32781781, 36634704, 7888671, 8164741, 8400292, 8705909, 9067500, 9136971, 9183305, 9454742, 9683579, 9698021, 9746774, 9886165, 9949170	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Venous Thrombosis	Venous thrombosis	Pubtator	15978106	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Vitiligo	Vitiligo	Pubtator	39969330	Inhibit	★☆☆☆☆ Found in Text Mining only
Von Hippel-Lindau Syndrome	Von Hippel-Lindau Syndrome	BEFREE	17954272, 8741802, 9143408		★☆☆☆☆ Found in Text Mining only
Well Differentiated Oligodendroglioma	Oligodendroglioma	BEFREE	7515658		★☆☆☆☆ Found in Text Mining only
West Syndrome	West Syndrome	BEFREE	27852007		★☆☆☆☆ Found in Text Mining only
Wilms Tumor	Wilms tumor	Pubtator	35436013	Associate	★☆☆☆☆ Found in Text Mining only