Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	5610
Gene name	Eukaryotic translation initiation factor 2 alpha kinase 2
Gene symbol	EIF2AK2
Synonyms (NCBI Gene)	DYT33EIF2AK1LEUDENPKRPPP1R83PRKR
Chromosome	2
Chromosome location	2p22.2
Summary	The protein encoded by this gene is a serine/threonine protein kinase that is activated by autophosphorylation after binding to dsRNA. The activated form of the encoded protein can phosphorylate translation initiation factor EIF2S1, which in turn inhibits

Show/Hide all (1)

SNP ID	Visualize variation	Clinical significance	Consequence
rs1573010519	C>T	Likely-pathogenic	Coding sequence variant, missense variant

265

Show/Hide all (265)

miRTarBase ID	miRNA	Experiments	Reference
MIRT019974	hsa-miR-375	qRT-PCR;Microarray	20584986
MIRT022755	hsa-miR-124-3p	Proteomics	18668037
MIRT046386	hsa-miR-15b-5p	CLASH	23622248
MIRT037216	hsa-miR-877-5p	CLASH	23622248
MIRT706575	hsa-miR-495-5p	HITS-CLIP	22927820
MIRT706574	hsa-miR-34b-3p	HITS-CLIP	22927820
MIRT706573	hsa-miR-510-5p	HITS-CLIP	22927820
MIRT706572	hsa-miR-4695-5p	HITS-CLIP	22927820
MIRT706571	hsa-miR-6808-5p	HITS-CLIP	22927820
MIRT706570	hsa-miR-6893-5p	HITS-CLIP	22927820
MIRT706569	hsa-miR-940	HITS-CLIP	22927820
MIRT706568	hsa-miR-3929	HITS-CLIP	22927820
MIRT706567	hsa-miR-4419b	HITS-CLIP	22927820
MIRT706566	hsa-miR-4478	HITS-CLIP	22927820
MIRT706565	hsa-miR-3614-5p	HITS-CLIP	22927820
MIRT706564	hsa-miR-6500-3p	HITS-CLIP	22927820
MIRT706563	hsa-miR-4768-3p	HITS-CLIP	22927820
MIRT706562	hsa-miR-4459	HITS-CLIP	22927820
MIRT706561	hsa-miR-4433a-3p	HITS-CLIP	22927820
MIRT706560	hsa-miR-3664-3p	HITS-CLIP	22927820
MIRT706559	hsa-miR-4649-3p	HITS-CLIP	22927820
MIRT706558	hsa-miR-485-5p	HITS-CLIP	22927820
MIRT706557	hsa-miR-6884-5p	HITS-CLIP	22927820
MIRT706556	hsa-miR-298	HITS-CLIP	22927820
MIRT706555	hsa-miR-4722-5p	HITS-CLIP	22927820
MIRT706554	hsa-miR-7160-5p	HITS-CLIP	22927820
MIRT706553	hsa-miR-665	HITS-CLIP	22927820
MIRT668600	hsa-miR-5196-3p	HITS-CLIP	23824327
MIRT668599	hsa-miR-3127-3p	HITS-CLIP	23824327
MIRT668598	hsa-miR-6756-3p	HITS-CLIP	23824327
MIRT668597	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT668596	hsa-miR-7158-5p	HITS-CLIP	23824327
MIRT668595	hsa-miR-202-5p	HITS-CLIP	23824327
MIRT395635	hsa-miR-4769-3p	HITS-CLIP	23824327
MIRT668594	hsa-miR-574-5p	HITS-CLIP	23824327
MIRT668593	hsa-miR-6867-5p	HITS-CLIP	23824327
MIRT668592	hsa-miR-4743-3p	HITS-CLIP	23824327
MIRT668591	hsa-miR-4652-3p	HITS-CLIP	23824327
MIRT668591	hsa-miR-4652-3p	HITS-CLIP	27418678
MIRT668591	hsa-miR-4652-3p	HITS-CLIP	27418678
MIRT668591	hsa-miR-4652-3p	HITS-CLIP	27418678
MIRT668591	hsa-miR-4652-3p	HITS-CLIP	27418678
MIRT668591	hsa-miR-4652-3p	HITS-CLIP	27418678
MIRT668592	hsa-miR-4743-3p	HITS-CLIP	27418678
MIRT668592	hsa-miR-4743-3p	HITS-CLIP	27418678
MIRT668592	hsa-miR-4743-3p	HITS-CLIP	27418678
MIRT668592	hsa-miR-4743-3p	HITS-CLIP	27418678
MIRT668592	hsa-miR-4743-3p	HITS-CLIP	27418678
MIRT668594	hsa-miR-574-5p	HITS-CLIP	27418678
MIRT668594	hsa-miR-574-5p	HITS-CLIP	27418678
MIRT668594	hsa-miR-574-5p	HITS-CLIP	27418678
MIRT668594	hsa-miR-574-5p	HITS-CLIP	27418678
MIRT668594	hsa-miR-574-5p	HITS-CLIP	27418678
MIRT668593	hsa-miR-6867-5p	HITS-CLIP	27418678
MIRT668593	hsa-miR-6867-5p	HITS-CLIP	27418678
MIRT668593	hsa-miR-6867-5p	HITS-CLIP	27418678
MIRT668593	hsa-miR-6867-5p	HITS-CLIP	27418678
MIRT668593	hsa-miR-6867-5p	HITS-CLIP	27418678
MIRT706575	hsa-miR-495-5p	HITS-CLIP	22927820
MIRT706574	hsa-miR-34b-3p	HITS-CLIP	22927820
MIRT706573	hsa-miR-510-5p	HITS-CLIP	22927820
MIRT706572	hsa-miR-4695-5p	HITS-CLIP	22927820
MIRT706571	hsa-miR-6808-5p	HITS-CLIP	22927820
MIRT706570	hsa-miR-6893-5p	HITS-CLIP	22927820
MIRT706569	hsa-miR-940	HITS-CLIP	22927820
MIRT706568	hsa-miR-3929	HITS-CLIP	22927820
MIRT706567	hsa-miR-4419b	HITS-CLIP	22927820
MIRT706566	hsa-miR-4478	HITS-CLIP	22927820
MIRT706565	hsa-miR-3614-5p	HITS-CLIP	22927820
MIRT706564	hsa-miR-6500-3p	HITS-CLIP	22927820
MIRT706563	hsa-miR-4768-3p	HITS-CLIP	22927820
MIRT706562	hsa-miR-4459	HITS-CLIP	22927820
MIRT706561	hsa-miR-4433a-3p	HITS-CLIP	22927820
MIRT706560	hsa-miR-3664-3p	HITS-CLIP	22927820
MIRT706559	hsa-miR-4649-3p	HITS-CLIP	22927820
MIRT706558	hsa-miR-485-5p	HITS-CLIP	22927820
MIRT706557	hsa-miR-6884-5p	HITS-CLIP	22927820
MIRT706556	hsa-miR-298	HITS-CLIP	22927820
MIRT706555	hsa-miR-4722-5p	HITS-CLIP	22927820
MIRT706554	hsa-miR-7160-5p	HITS-CLIP	22927820
MIRT706553	hsa-miR-665	HITS-CLIP	22927820
MIRT668600	hsa-miR-5196-3p	HITS-CLIP	23824327
MIRT668599	hsa-miR-3127-3p	HITS-CLIP	23824327
MIRT668598	hsa-miR-6756-3p	HITS-CLIP	23824327
MIRT668597	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT668596	hsa-miR-7158-5p	HITS-CLIP	23824327
MIRT668595	hsa-miR-202-5p	HITS-CLIP	23824327
MIRT395635	hsa-miR-4769-3p	HITS-CLIP	23824327
MIRT668594	hsa-miR-574-5p	HITS-CLIP	23824327
MIRT668593	hsa-miR-6867-5p	HITS-CLIP	23824327
MIRT668592	hsa-miR-4743-3p	HITS-CLIP	23824327
MIRT668591	hsa-miR-4652-3p	HITS-CLIP	23824327
MIRT956547	hsa-miR-1827	CLIP-seq
MIRT956548	hsa-miR-3122	CLIP-seq
MIRT956549	hsa-miR-3165	CLIP-seq
MIRT956550	hsa-miR-3665	CLIP-seq
MIRT956551	hsa-miR-3689a-3p	CLIP-seq
MIRT956552	hsa-miR-3689c	CLIP-seq
MIRT956553	hsa-miR-3913-5p	CLIP-seq
MIRT956554	hsa-miR-4433	CLIP-seq
MIRT956555	hsa-miR-4728-5p	CLIP-seq
MIRT956556	hsa-miR-4736	CLIP-seq
MIRT956557	hsa-miR-1207-3p	CLIP-seq
MIRT956558	hsa-miR-1262	CLIP-seq
MIRT956559	hsa-miR-1293	CLIP-seq
MIRT956560	hsa-miR-1294	CLIP-seq
MIRT956547	hsa-miR-1827	CLIP-seq
MIRT956561	hsa-miR-3074-3p	CLIP-seq
MIRT956562	hsa-miR-3120-5p	CLIP-seq
MIRT956563	hsa-miR-361-5p	CLIP-seq
MIRT956564	hsa-miR-3664-5p	CLIP-seq
MIRT956565	hsa-miR-3919	CLIP-seq
MIRT956566	hsa-miR-3925-3p	CLIP-seq
MIRT956567	hsa-miR-3925-5p	CLIP-seq
MIRT956568	hsa-miR-4259	CLIP-seq
MIRT956569	hsa-miR-4267	CLIP-seq
MIRT956570	hsa-miR-4316	CLIP-seq
MIRT956554	hsa-miR-4433	CLIP-seq
MIRT956571	hsa-miR-448	CLIP-seq
MIRT956572	hsa-miR-4483	CLIP-seq
MIRT956573	hsa-miR-4501	CLIP-seq
MIRT956574	hsa-miR-4522	CLIP-seq
MIRT956575	hsa-miR-4701-3p	CLIP-seq
MIRT956576	hsa-miR-4715-5p	CLIP-seq
MIRT956577	hsa-miR-510	CLIP-seq
MIRT956578	hsa-miR-511	CLIP-seq
MIRT956579	hsa-miR-512-5p	CLIP-seq
MIRT956580	hsa-miR-515-5p	CLIP-seq
MIRT956581	hsa-miR-766	CLIP-seq
MIRT1920405	hsa-miR-4773	CLIP-seq
MIRT1920406	hsa-miR-587	CLIP-seq
MIRT1920407	hsa-miR-876-3p	CLIP-seq
MIRT1983267	hsa-miR-1285	CLIP-seq
MIRT956560	hsa-miR-1294	CLIP-seq
MIRT1983268	hsa-miR-129-5p	CLIP-seq
MIRT1983269	hsa-miR-143	CLIP-seq
MIRT956547	hsa-miR-1827	CLIP-seq
MIRT1983270	hsa-miR-24	CLIP-seq
MIRT1983271	hsa-miR-2467-5p	CLIP-seq
MIRT1983272	hsa-miR-25	CLIP-seq
MIRT956549	hsa-miR-3165	CLIP-seq
MIRT1983273	hsa-miR-3178	CLIP-seq
MIRT1983274	hsa-miR-3187-5p	CLIP-seq
MIRT1983275	hsa-miR-3188	CLIP-seq
MIRT1983276	hsa-miR-32	CLIP-seq
MIRT1983277	hsa-miR-34b	CLIP-seq
MIRT1983278	hsa-miR-363	CLIP-seq
MIRT1983279	hsa-miR-367	CLIP-seq
MIRT956565	hsa-miR-3919	CLIP-seq
MIRT956567	hsa-miR-3925-5p	CLIP-seq
MIRT1983280	hsa-miR-3975	CLIP-seq
MIRT956569	hsa-miR-4267	CLIP-seq
MIRT1983281	hsa-miR-4284	CLIP-seq
MIRT956570	hsa-miR-4316	CLIP-seq
MIRT1983282	hsa-miR-4317	CLIP-seq
MIRT1983283	hsa-miR-4325	CLIP-seq
MIRT956554	hsa-miR-4433	CLIP-seq
MIRT1983284	hsa-miR-4486	CLIP-seq
MIRT956573	hsa-miR-4501	CLIP-seq
MIRT1983285	hsa-miR-4505	CLIP-seq
MIRT1983286	hsa-miR-4770	CLIP-seq
MIRT1983287	hsa-miR-508-5p	CLIP-seq
MIRT956577	hsa-miR-510	CLIP-seq
MIRT956579	hsa-miR-512-5p	CLIP-seq
MIRT1983288	hsa-miR-592	CLIP-seq
MIRT1983289	hsa-miR-597	CLIP-seq
MIRT1983290	hsa-miR-600	CLIP-seq
MIRT1983291	hsa-miR-612	CLIP-seq
MIRT1983292	hsa-miR-616	CLIP-seq
MIRT1983293	hsa-miR-661	CLIP-seq
MIRT956581	hsa-miR-766	CLIP-seq
MIRT1983294	hsa-miR-892a	CLIP-seq
MIRT1983295	hsa-miR-92a	CLIP-seq
MIRT1983296	hsa-miR-92b	CLIP-seq
MIRT1983267	hsa-miR-1285	CLIP-seq
MIRT956560	hsa-miR-1294	CLIP-seq
MIRT1983269	hsa-miR-143	CLIP-seq
MIRT956547	hsa-miR-1827	CLIP-seq
MIRT1983271	hsa-miR-2467-5p	CLIP-seq
MIRT1983272	hsa-miR-25	CLIP-seq
MIRT1983273	hsa-miR-3178	CLIP-seq
MIRT1983274	hsa-miR-3187-5p	CLIP-seq
MIRT1983275	hsa-miR-3188	CLIP-seq
MIRT1983276	hsa-miR-32	CLIP-seq
MIRT1983277	hsa-miR-34b	CLIP-seq
MIRT1983278	hsa-miR-363	CLIP-seq
MIRT1983279	hsa-miR-367	CLIP-seq
MIRT956565	hsa-miR-3919	CLIP-seq
MIRT956567	hsa-miR-3925-5p	CLIP-seq
MIRT1983280	hsa-miR-3975	CLIP-seq
MIRT956569	hsa-miR-4267	CLIP-seq
MIRT956570	hsa-miR-4316	CLIP-seq
MIRT1983282	hsa-miR-4317	CLIP-seq
MIRT1983283	hsa-miR-4325	CLIP-seq
MIRT956554	hsa-miR-4433	CLIP-seq
MIRT1983284	hsa-miR-4486	CLIP-seq
MIRT956573	hsa-miR-4501	CLIP-seq
MIRT1983285	hsa-miR-4505	CLIP-seq
MIRT1983286	hsa-miR-4770	CLIP-seq
MIRT1983287	hsa-miR-508-5p	CLIP-seq
MIRT956577	hsa-miR-510	CLIP-seq
MIRT956579	hsa-miR-512-5p	CLIP-seq
MIRT1983288	hsa-miR-592	CLIP-seq
MIRT1983289	hsa-miR-597	CLIP-seq
MIRT1983291	hsa-miR-612	CLIP-seq
MIRT1983292	hsa-miR-616	CLIP-seq
MIRT1983293	hsa-miR-661	CLIP-seq
MIRT956581	hsa-miR-766	CLIP-seq
MIRT1983294	hsa-miR-892a	CLIP-seq
MIRT1983295	hsa-miR-92a	CLIP-seq
MIRT1983296	hsa-miR-92b	CLIP-seq
MIRT1983267	hsa-miR-1285	CLIP-seq
MIRT956547	hsa-miR-1827	CLIP-seq
MIRT1983272	hsa-miR-25	CLIP-seq
MIRT956562	hsa-miR-3120-5p	CLIP-seq
MIRT1983274	hsa-miR-3187-5p	CLIP-seq
MIRT1983276	hsa-miR-32	CLIP-seq
MIRT1983278	hsa-miR-363	CLIP-seq
MIRT956564	hsa-miR-3664-5p	CLIP-seq
MIRT1983279	hsa-miR-367	CLIP-seq
MIRT1983282	hsa-miR-4317	CLIP-seq
MIRT1983283	hsa-miR-4325	CLIP-seq
MIRT956554	hsa-miR-4433	CLIP-seq
MIRT956574	hsa-miR-4522	CLIP-seq
MIRT1983287	hsa-miR-508-5p	CLIP-seq
MIRT956578	hsa-miR-511	CLIP-seq
MIRT1983291	hsa-miR-612	CLIP-seq
MIRT1983292	hsa-miR-616	CLIP-seq
MIRT1983293	hsa-miR-661	CLIP-seq
MIRT956581	hsa-miR-766	CLIP-seq
MIRT1983295	hsa-miR-92a	CLIP-seq
MIRT1983296	hsa-miR-92b	CLIP-seq
MIRT1983267	hsa-miR-1285	CLIP-seq
MIRT956547	hsa-miR-1827	CLIP-seq
MIRT1983272	hsa-miR-25	CLIP-seq
MIRT956562	hsa-miR-3120-5p	CLIP-seq
MIRT956548	hsa-miR-3122	CLIP-seq
MIRT956549	hsa-miR-3165	CLIP-seq
MIRT1983274	hsa-miR-3187-5p	CLIP-seq
MIRT1983276	hsa-miR-32	CLIP-seq
MIRT2679870	hsa-miR-339-5p	CLIP-seq
MIRT1983278	hsa-miR-363	CLIP-seq
MIRT956564	hsa-miR-3664-5p	CLIP-seq
MIRT956550	hsa-miR-3665	CLIP-seq
MIRT1983279	hsa-miR-367	CLIP-seq
MIRT956551	hsa-miR-3689a-3p	CLIP-seq
MIRT956552	hsa-miR-3689c	CLIP-seq
MIRT956553	hsa-miR-3913-5p	CLIP-seq
MIRT956569	hsa-miR-4267	CLIP-seq
MIRT1983282	hsa-miR-4317	CLIP-seq
MIRT1983283	hsa-miR-4325	CLIP-seq
MIRT956554	hsa-miR-4433	CLIP-seq
MIRT956574	hsa-miR-4522	CLIP-seq
MIRT956555	hsa-miR-4728-5p	CLIP-seq
MIRT956556	hsa-miR-4736	CLIP-seq
MIRT1983287	hsa-miR-508-5p	CLIP-seq
MIRT956577	hsa-miR-510	CLIP-seq
MIRT956578	hsa-miR-511	CLIP-seq
MIRT956579	hsa-miR-512-5p	CLIP-seq
MIRT1983291	hsa-miR-612	CLIP-seq
MIRT1983292	hsa-miR-616	CLIP-seq
MIRT1983293	hsa-miR-661	CLIP-seq
MIRT956581	hsa-miR-766	CLIP-seq
MIRT1983295	hsa-miR-92a	CLIP-seq
MIRT1983296	hsa-miR-92b	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
IRF1	Activation	8622878

Show/Hide all (80)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0001819	Process	Positive regulation of cytokine production	IEA
GO:0001819	Process	Positive regulation of cytokine production	ISS
GO:0002376	Process	Immune system process	IEA
GO:0003723	Function	RNA binding	HDA	22681889
GO:0003723	Function	RNA binding	IEA
GO:0003725	Function	Double-stranded RNA binding	IDA	21266579
GO:0003725	Function	Double-stranded RNA binding	IEA
GO:0003725	Function	Double-stranded RNA binding	TAS	1351683
GO:0004672	Function	Protein kinase activity	IDA	12882984, 15229216, 18835251, 22948139
GO:0004672	Function	Protein kinase activity	IEA
GO:0004672	Function	Protein kinase activity	IMP	21123651
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	TAS	1695551
GO:0004694	Function	Eukaryotic translation initiation factor 2alpha kinase activity	IBA
GO:0004694	Function	Eukaryotic translation initiation factor 2alpha kinase activity	IMP	25329545
GO:0004694	Function	Eukaryotic translation initiation factor 2alpha kinase activity	TAS	10866685
GO:0004713	Function	Protein tyrosine kinase activity	IEA
GO:0004715	Function	Non-membrane spanning protein tyrosine kinase activity	IEA
GO:0005515	Function	Protein binding	IPI	8576172, 9143277, 9431994, 10390359, 10488152, 11160738, 11773402, 11836380, 12610133, 12882984, 15121867, 15229216, 16288713, 16785445, 16957780, 18096616, 18362360, 18835251, 18971339, 20395957, 21903422, 22801494, 23455922, 32296183, 32707033, 33961781, 34035218, 34578187, 347800
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	21123651
GO:0005737	Component	Cytoplasm	IDA	15121867
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005840	Component	Ribosome	TAS	10390359
GO:0006412	Process	Translation	IEA
GO:0006413	Process	Translational initiation	IDA	10563826, 12133843
GO:0006446	Process	Regulation of translational initiation	IBA
GO:0006468	Process	Protein phosphorylation	IDA	19189853
GO:0006468	Process	Protein phosphorylation	TAS	1695551
GO:0008285	Process	Negative regulation of cell population proliferation	TAS	1351683
GO:0009615	Process	Response to virus	IMP	19189853
GO:0016020	Component	Membrane	HDA	19946888
GO:0016301	Function	Kinase activity	IDA	21123651
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0017148	Process	Negative regulation of translation	IBA
GO:0017148	Process	Negative regulation of translation	IDA	12882984
GO:0017148	Process	Negative regulation of translation	IMP	12610133, 19189853
GO:0019888	Function	Protein phosphatase regulator activity	TAS	10866685
GO:0030968	Process	Endoplasmic reticulum unfolded protein response	IEA
GO:0032722	Process	Positive regulation of chemokine production	IEA
GO:0032722	Process	Positive regulation of chemokine production	ISS
GO:0032874	Process	Positive regulation of stress-activated MAPK cascade	IEA
GO:0032874	Process	Positive regulation of stress-activated MAPK cascade	ISS
GO:0033689	Process	Negative regulation of osteoblast proliferation	IMP	16216244
GO:0034198	Process	Cellular response to amino acid starvation	IEA
GO:0034198	Process	Cellular response to amino acid starvation	IMP	25329545
GO:0035455	Process	Response to interferon-alpha	IDA	19840259
GO:0042802	Function	Identical protein binding	IPI	16373505
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0043410	Process	Positive regulation of MAPK cascade	IMP	15229216
GO:0045071	Process	Negative regulation of viral genome replication	IEA
GO:0045071	Process	Negative regulation of viral genome replication	IMP	19189853, 19840259
GO:0045087	Process	Innate immune response	IEA
GO:0046777	Process	Protein autophosphorylation	IDA	22801494
GO:0046777	Process	Protein autophosphorylation	IMP	16216244
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	15121867
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0051092	Process	Positive regulation of NF-kappaB transcription factor activity	IDA	15121867
GO:0051607	Process	Defense response to virus	IEA
GO:0051607	Process	Defense response to virus	IEP	32634389
GO:0106310	Function	Protein serine kinase activity	IEA
GO:0140374	Process	Antiviral innate immune response	IDA	22948139
GO:1900225	Process	Regulation of NLRP3 inflammasome complex assembly	IEA
GO:1900225	Process	Regulation of NLRP3 inflammasome complex assembly	ISS
GO:1901224	Process	Positive regulation of non-canonical NF-kappaB signal transduction	IEA
GO:1901224	Process	Positive regulation of non-canonical NF-kappaB signal transduction	ISS
GO:1901532	Process	Regulation of hematopoietic progenitor cell differentiation	IEA
GO:1901532	Process	Regulation of hematopoietic progenitor cell differentiation	ISS
GO:1902033	Process	Regulation of hematopoietic stem cell proliferation	IEA
GO:1902033	Process	Regulation of hematopoietic stem cell proliferation	ISS
GO:1902036	Process	Regulation of hematopoietic stem cell differentiation	IEA
GO:1902036	Process	Regulation of hematopoietic stem cell differentiation	ISS

MIM	HGNC	e!Ensembl
176871	9437	ENSG00000055332

P19525

Protein name

Interferon-induced, double-stranded RNA-activated protein kinase (EC 2.7.11.1) (Eukaryotic translation initiation factor 2-alpha kinase 2) (eIF-2A protein kinase 2) (Interferon-inducible RNA-dependent protein kinase) (P1/eIF-2A protein kinase) (Protein ki

Protein function

IFN-induced dsRNA-dependent serine/threonine-protein kinase that phosphorylates the alpha subunit of eukaryotic translation initiation factor 2 (EIF2S1/eIF-2-alpha) and plays a key role in the innate immune response to viral infection (PubMed:18

PDB

1QU6 , 2A19 , 2A1A , 3UIU , 6D3K , 6D3L , 7OBK , 7OBL , 8BI7 , 8I9J , 8IZN

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00035	dsrm	10 → 75	Double-stranded RNA binding motif	Domain
PF00035	dsrm	101 → 165	Double-stranded RNA binding motif	Domain
PF00069	Pkinase	267 → 537	Protein kinase domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in thymus, spleen and bone marrow compared to non-hematopoietic tissues such as small intestine, liver, or kidney tissues. Colocalizes with GSK3B and TAU in the Alzheimer disease (AD) brain. Elevated levels seen in bre

Sequence

MAGDLSAGFFMEELNTYRQKQGVVLKYQELPNSGPPHDRRFTFQVIIDGREFPEGEGRSK
KEAKNAAAKLAVEILNKEKKAVSPLLLTTTNSSEGLSMGNYIGLINRIAQKKRLTVNYEQ
CASGVHGPEGFHYKCKMGQKEYSIGTGSTKQEAKQLAAKLAYLQILSEETSVKSDYLSSG
SFATTCESQSNSLVTSTLASESSSEGDFSADTSEINSNSDSLNSSSLLMNGLRNNQRKAK
RSLAPRFDLPDMKETKYTVDKRFGMDFKEIELIGSGGFGQVFKAKHRIDGKTYVIKRVKY
NNEKAEREVKALAKLDHVNIVHYNGCWDGFDYDPETSDDSLESSDYDPENSKNSSRSKTK
CLFIQMEFCDKGTLEQWIEKRRGEKLDKVLALELFEQITKGVDYIHSKKLIHRDLKPSNI
FLVDTKQVKIGDFGLVTSLKNDGKRTRSKGTLRYMSPEQISSQDYGKEVDLYALGLILAE
LLHVCDTAFETSKFFTDLRDGIISDIFDKKEKTLLQKLLSKKPEDRPNTSEILRTLTVWK
KSPEKNERHTC

Sequence length

551

Interactions

View interactions

	KEGG		Reactome
	Necroptosis Alzheimer disease Hepatitis C Measles Influenza A Human papillomavirus infection Kaposi sarcoma-associated herpesvirus infection Herpes simplex virus 1 infection Epstein-Barr virus infection Coronavirus disease - COVID-19 Viral carcinogenesis		ISG15 antiviral mechanism Inhibition of PKR

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (2)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Dystonia 33	Likely pathogenic; Pathogenic	rs2148705154	RCV001807542 RCV001807544	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Leukoencephalopathy, developmental delay, and episodic neurologic regression syndrome	Likely pathogenic	rs2148703089	RCV001527613	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (21)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMERS DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cognitive impairment	Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Developmental regression	Uncertain significance; Conflicting classifications of pathogenicity	ClinVar Disgenet	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
DYSTONIA 1, TORSION, AUTOSOMAL DOMINANT	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EARLY ONSET TORSION DYSTONIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EARLY-ONSET GENERALIZED LIMB-ONSET DYSTONIA	—	CTD, Orphanet CTD, Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EIF2AK2-related disorder	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Global developmental delay	Uncertain significance; Conflicting classifications of pathogenicity	ClinVar Disgenet	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
GOUT	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATITIS B	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HUNTINGTON DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Leukoencephalopathy	Uncertain significance; Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STATUS EPILEPTICUS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (145)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute leukemia	Leukemia	BEFREE	14961569		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	15607693		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	26202421, 26405214		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	15607693		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	19210572, 20067632	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	14989595		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Reactive	Reactive arthritis	Pubtator	23349666	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	26399222		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	26399222	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ataxia	Ataxia	Pubtator	32197074	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	19337998, 31031002	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	29537336		★★★★★ ★☆☆☆☆ Found in Text Mining only
Avellino corneal dystrophy	Avellino Corneal Dystrophy	BEFREE	27373828		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-CELL MALIGNANCY, LOW-GRADE	Lymphocytic Leukemia	BEFREE	14961569		★★★★★ ★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	11431747		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Marrow Failure Disorders	Bone marrow failure syndromes	Pubtator	21659535	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	12860279, 18490711, 23029376, 29053414		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	18490711, 18559534, 23029376, 23112838	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	11867523	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	12882984	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	18446370, 21518807, 22926522, 33749640	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	23029376	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	19259124, 22894766, 23844083, 30794626, 32106574	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	23029376	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	30076923		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	15607693		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	22926522	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	14961569		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	LHGDN	14961569		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	19210572, 32197074	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	28300830, 33749640	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Complex Partial Status Epilepticus	Status Epilepticus	CTD_human_DG	16492139		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	28869834		★★★★★ ★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Developmental disability	Pubtator	32197074	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	27106634	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	27106634		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dysarthria	Dysarthria	Pubtator	32197074	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyskinesias	Dyskinesia	Pubtator	32197074	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dystonia	Dystonia	Pubtator	26231208, 33049316, 33236446	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	BEFREE	14698665		★★★★★ ★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	LHGDN	14698665		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	29844817		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	16153435		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	16153435		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	35436983	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi Anemia	BEFREE	12882984		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi Anemia	LHGDN	12882984		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi anemia	Pubtator	12882984, 15299030	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
FANCONI ANEMIA, COMPLEMENTATION GROUP A (disorder)	Anemia	BEFREE	12882984		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatigue Syndrome Chronic	Fatigue syndrome	Pubtator	9437407	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver Alcoholic	Fatty liver, alcoholic	Pubtator	30794626	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	16084774		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	16084774, 29486283		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	35406793	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Grand Mal Status Epilepticus	Grand Mal Status Epilepticus	CTD_human_DG	16492139		★★★★★ ★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves disease	Pubtator	33367784	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	32197074	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	9041199		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	18336742	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	23844083, 24486950, 33248325	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis C Chronic	Hepatitis c	Pubtator	32106574	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis Chronic	Hepatitis	Pubtator	22894766	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	11468270, 14989595		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperplasia	Hyperplasia	Pubtator	23029376	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	28982375		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	25607115		★★★★★ ★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	23519983	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Intellectual developmental disorder	Pubtator	32197074, 33236446	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	17108038		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	30507607		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasm	Kidney Neoplasm	BEFREE	23155228		★★★★★ ★☆☆☆☆ Found in Text Mining only
Language Disorders	Language development disorders	Pubtator	32197074	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	14961569, 26202421, 26405214		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	26202421, 26405214		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukodystrophy Metachromatic	Metachromatic leukodystrophy	Pubtator	32197074	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	11431747, 11804673, 14638359, 15122791, 18535617, 22894766, 23844083, 26753564, 31523192		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	14638359, 15122791		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	17526009	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	32106574	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	18535617		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	20930042, 22102852, 25798539, 27203671, 33562773	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	11120763, 27257790, 35757721	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	31031002	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	11120763, 29781188		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	20930042	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	23029376	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoid leukemia	Lymphoid leukemia	BEFREE	9806790		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative Disorder	BEFREE	23254370		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	12860279, 18490711, 23029376, 29053414		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	29844817		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	16153435		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	17199135		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	28445962		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	27612419		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10216939, 10216948, 11068051, 11185959, 15174900, 16084774, 16123598, 22894766, 27612419, 28724458, 28944853, 29486283, 30159133, 30518569, 31086176		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	15174900, 24850177		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	21338484, 24850177	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mild cognitive disorder	Cognitive disorder	BEFREE	28982375		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	34384424, 35421271	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	35677537	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	16474427		★★★★★ ★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	26405214		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	21659535	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	Pubtator	20479119, 33856033	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	36683218	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10216948, 12928526, 15174900, 18535617, 22102852, 22894766, 26168134, 26318295, 27612419, 28817603, 29537336, 30159133, 30420615, 7641700, 7678339, 9806790 View all (1 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	13678666		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	22306812, 24334130		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	29170442	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	14989595, 28724458, 29170442		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Convulsive Status Epilepticus	Nonconvulsive status epilepticus	CTD_human_DG	16492139		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	22102852		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	23519983	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	27106634		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	28869834	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	11838900, 17014383		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	17014383, 23527187	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	15299030, 37107677	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Peripheral Arterial Diseases	Vascular Diseases	BEFREE	25587101		★★★★★ ★☆☆☆☆ Found in Text Mining only
Petit mal status	Petit Mal Status	CTD_human_DG	16492139		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	28445962		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	17199135		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	28445962		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	Pubtator	17928888	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	30825198		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	26782432		★★★★★ ★☆☆☆☆ Found in Text Mining only
Senile Plaques	Senile Plaques	BEFREE	13678666		★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	27779186, 30507610		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	17928888	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	12928526		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Deprivation	Sleep deprivation	Pubtator	15516717	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	12928526, 23029376		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	9422082	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	24634103		★★★★★ ★☆☆☆☆ Found in Text Mining only
Status Epilepticus	Status Epilepticus	CTD_human_DG	16492139		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Status Epilepticus, Subclinical	Status Epilepticus	CTD_human_DG	16492139		★★★★★ ★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	17541615		★★★★★ ★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	16084774		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	10923918, 27612419		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	27612419		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	27612419	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
TUBEROUS SCLEROSIS 2 (disorder)	Tuberous Sclerosis	BEFREE	19631745		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vanishing White Matter Leukodystrophy with Ovarian Failure	Vanishing white matter disease	Pubtator	32197074	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vesicular Stomatitis	Vesicular Stomatitis	BEFREE	11838900, 2545700		★★★★★ ★☆☆☆☆ Found in Text Mining only

EIF2AK2 (eukaryotic translation initiation factor 2 alpha kinase 2)