PDGFC (platelet derived growth factor C)

Gene

• Entrez ID: 56034
• Gene name: Platelet derived growth factor C
• Gene symbol: PDGFC
• Synonyms (NCBI Gene): FALLOTEIN, SCDGF
• Chromosome: 4
• Chromosome location: 4q32.1
• Summary: The protein encoded by this gene is a member of the platelet-derived growth factor family. The four members of this family are mitogenic factors for cells of mesenchymal origin and are characterized by a core motif of eight cysteines. This gene product ap

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT019758	hsa-miR-375	Microarray	20215506
MIRT022407	hsa-miR-124-3p	Microarray	18668037
MIRT025672	hsa-miR-7-5p	Microarray	17612493
MIRT040332	hsa-miR-615-3p	CLASH	23622248
MIRT438913	hsa-miR-29b-3p	Luciferase reporter assay, qRT-PCR	23354167
MIRT438913	hsa-miR-29b-3p	Luciferase reporter assay, qRT-PCR	23354167
MIRT732494	hsa-miR-29a-5p	Western blotting, Immunocytochemistry (ICC), Luciferase reporter assay, qRT-PCR	31482267
MIRT019758	hsa-miR-375	Western blotting, Microarray, Immunohistochemistry (IHC), qRT-PCR	32616906
MIRT1221209	hsa-miR-3671	CLIP-seq
MIRT1221210	hsa-miR-548p	CLIP-seq
MIRT1221211	hsa-miR-607	CLIP-seq
MIRT2063838	hsa-miR-127-5p	CLIP-seq
MIRT2063839	hsa-miR-4635	CLIP-seq
MIRT2063838	hsa-miR-127-5p	CLIP-seq
MIRT2292314	hsa-miR-3674	CLIP-seq
MIRT2292315	hsa-miR-376c	CLIP-seq
MIRT2292316	hsa-miR-4464	CLIP-seq
MIRT2063839	hsa-miR-4635	CLIP-seq
MIRT2292317	hsa-miR-4731-3p	CLIP-seq
MIRT2292318	hsa-miR-4748	CLIP-seq
MIRT2292319	hsa-miR-4801	CLIP-seq
MIRT2292320	hsa-miR-548aa	CLIP-seq
MIRT2292321	hsa-miR-548ac	CLIP-seq
MIRT2292322	hsa-miR-548ae	CLIP-seq
MIRT2292323	hsa-miR-548aj	CLIP-seq
MIRT2292324	hsa-miR-548am	CLIP-seq
MIRT2292325	hsa-miR-548d-3p	CLIP-seq
MIRT2292326	hsa-miR-548x	CLIP-seq
MIRT2292327	hsa-miR-548z	CLIP-seq
MIRT2456133	hsa-miR-4666-5p	CLIP-seq
MIRT2590060	hsa-miR-106a	CLIP-seq
MIRT2590061	hsa-miR-106b	CLIP-seq
MIRT2590062	hsa-miR-1245b-5p	CLIP-seq
MIRT2590063	hsa-miR-1276	CLIP-seq
MIRT2590064	hsa-miR-1295	CLIP-seq
MIRT2590065	hsa-miR-138	CLIP-seq
MIRT2590066	hsa-miR-142-5p	CLIP-seq
MIRT2590067	hsa-miR-17	CLIP-seq
MIRT2590068	hsa-miR-1976	CLIP-seq
MIRT2590069	hsa-miR-20a	CLIP-seq
MIRT2590070	hsa-miR-20b	CLIP-seq
MIRT2590071	hsa-miR-3124-3p	CLIP-seq
MIRT2590072	hsa-miR-3133	CLIP-seq
MIRT2590073	hsa-miR-3142	CLIP-seq
MIRT2590074	hsa-miR-3183	CLIP-seq
MIRT2590075	hsa-miR-323-3p	CLIP-seq
MIRT2590076	hsa-miR-3609	CLIP-seq
MIRT2590077	hsa-miR-3681	CLIP-seq
MIRT2590078	hsa-miR-3692	CLIP-seq
MIRT2590079	hsa-miR-371-5p	CLIP-seq
MIRT2590080	hsa-miR-371b-5p	CLIP-seq
MIRT2590081	hsa-miR-374c	CLIP-seq
MIRT2590082	hsa-miR-4279	CLIP-seq
MIRT2590083	hsa-miR-4299	CLIP-seq
MIRT2590084	hsa-miR-4421	CLIP-seq
MIRT2590085	hsa-miR-4511	CLIP-seq
MIRT2590086	hsa-miR-4661-5p	CLIP-seq
MIRT2590087	hsa-miR-4684-3p	CLIP-seq
MIRT2590088	hsa-miR-4699-5p	CLIP-seq
MIRT2590089	hsa-miR-4709-3p	CLIP-seq
MIRT2590090	hsa-miR-4714-5p	CLIP-seq
MIRT2590091	hsa-miR-4723-3p	CLIP-seq
MIRT2590092	hsa-miR-4738-3p	CLIP-seq
MIRT2590093	hsa-miR-4753-5p	CLIP-seq
MIRT2590094	hsa-miR-4766-5p	CLIP-seq
MIRT2590095	hsa-miR-4775	CLIP-seq
MIRT2590096	hsa-miR-4796-3p	CLIP-seq
MIRT2590097	hsa-miR-4802-3p	CLIP-seq
MIRT2590098	hsa-miR-519d	CLIP-seq
MIRT2590099	hsa-miR-548ah	CLIP-seq
MIRT2590100	hsa-miR-590-3p	CLIP-seq
MIRT2590101	hsa-miR-618	CLIP-seq
MIRT2590102	hsa-miR-655	CLIP-seq
MIRT2590103	hsa-miR-93	CLIP-seq
MIRT2590062	hsa-miR-1245b-5p	CLIP-seq
MIRT2590064	hsa-miR-1295	CLIP-seq
MIRT2590065	hsa-miR-138	CLIP-seq
MIRT2590068	hsa-miR-1976	CLIP-seq
MIRT2590071	hsa-miR-3124-3p	CLIP-seq
MIRT2590072	hsa-miR-3133	CLIP-seq
MIRT2590073	hsa-miR-3142	CLIP-seq
MIRT2590075	hsa-miR-323-3p	CLIP-seq
MIRT2590077	hsa-miR-3681	CLIP-seq
MIRT2590078	hsa-miR-3692	CLIP-seq
MIRT2590081	hsa-miR-374c	CLIP-seq
MIRT2590082	hsa-miR-4279	CLIP-seq
MIRT2590083	hsa-miR-4299	CLIP-seq
MIRT2590084	hsa-miR-4421	CLIP-seq
MIRT2590085	hsa-miR-4511	CLIP-seq
MIRT2590086	hsa-miR-4661-5p	CLIP-seq
MIRT2590089	hsa-miR-4709-3p	CLIP-seq
MIRT2590092	hsa-miR-4738-3p	CLIP-seq
MIRT2590095	hsa-miR-4775	CLIP-seq
MIRT2590097	hsa-miR-4802-3p	CLIP-seq
MIRT2590100	hsa-miR-590-3p	CLIP-seq
MIRT2590102	hsa-miR-655	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
EGR1	Activation	15247255
SP1	Unknown	15247255

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	TAS
GO:0005161	Function	Platelet-derived growth factor receptor binding	IBA
GO:0005161	Function	Platelet-derived growth factor receptor binding	IEA
GO:0005161	Function	Platelet-derived growth factor receptor binding	IPI	10806482
GO:0005515	Function	Protein binding	IPI	10806482, 11297552, 20534510, 35384245
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	10806482
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005788	Component	Endoplasmic reticulum lumen	TAS
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	IEA
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0007417	Process	Central nervous system development	TAS	10858496
GO:0008083	Function	Growth factor activity	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IBA
GO:0008284	Process	Positive regulation of cell population proliferation	IDA	10806482
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0009887	Process	Animal organ morphogenesis	IEA
GO:0009986	Component	Cell surface	IDA	10806482
GO:0016020	Component	Membrane	IEA
GO:0030335	Process	Positive regulation of cell migration	IBA
GO:0042803	Function	Protein homodimerization activity	IPI	10806482
GO:0048008	Process	Platelet-derived growth factor receptor signaling pathway	IBA
GO:0048008	Process	Platelet-derived growth factor receptor signaling pathway	IDA	10806482
GO:0048008	Process	Platelet-derived growth factor receptor signaling pathway	IEA
GO:0048144	Process	Fibroblast proliferation	IEA
GO:0048146	Process	Positive regulation of fibroblast proliferation	IDA	10806482
GO:0048146	Process	Positive regulation of fibroblast proliferation	IEA
GO:0048565	Process	Digestive tract development	IEA
GO:0051781	Process	Positive regulation of cell division	IEA
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IBA
GO:0060348	Process	Bone development	IEA
GO:0070062	Component	Extracellular exosome	HDA	19199708
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IBA
GO:0071230	Process	Cellular response to amino acid stimulus	IEA
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	IEA
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	ISS	27492130

Other IDs

• MIM: 608452
• HGNC: 8801
• e!Ensembl: ENSG00000145431

Protein

• UniProt ID: Q9NRA1
• Protein name: Platelet-derived growth factor C (PDGF-C) (Fallotein) (Spinal cord-derived growth factor) (SCDGF) (VEGF-E) [Cleaved into: Platelet-derived growth factor C, latent form (PDGFC latent form); Platelet-derived growth factor C, receptor-binding form (PDGFC rec
• Protein function: Growth factor that plays an essential role in the regulation of embryonic development, cell proliferation, cell migration, survival and chemotaxis. Potent mitogen and chemoattractant for cells of mesenchymal origin. Required for normal skeleton
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00431	CUB	47 → 160	CUB domain	Domain
  PF00341	PDGF	250 → 337	PDGF/VEGF domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in the fallopian tube, vascular smooth muscle cells in kidney, breast and colon and in visceral smooth muscle of the gastrointestinal tract. Highly expressed in retinal pigment epithelia. Expressed in medulloblastoma. In the
• Sequence:

  MSLFGLLLLTSALAGQRQGTQAESNLSSKFQFSSNKEQNGVQDPQHERIITVSTNGSIHS
  PRFPHTYPRNTVLVWRLVAVEENVWIQLTFDERFGLEDPEDDICKYDFVEVEEPSDGTIL
  GRWCGSGTVPGKQISKGNQIRIRFVSDEYFPSEPGFCIHYNIVMPQFTEAVSPSVLPPSA
  LPLDLLNNAITAFSTLEDLIRYLEPERWQLDLEDLYRPTWQLLGKAFVFGRKSRVVDLNL
  LTEEVRLYSCTPRNFSVSIREELKRTDTIFWPGCLLVKRCGGNCACCLHNCNECQCVPSK
  VTKKYHEVLQLRPKTGVRGLHKSLTDVALEHHEECDCVCRGSTGG

• Sequence length: 345

Pathways

KEGG:

EGFR tyrosine kinase inhibitor resistance
MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
Calcium signaling pathway
Phospholipase D signaling pathway
PI3K-Akt signaling pathway
Focal adhesion
Gap junction
Regulation of actin cytoskeleton
Prostate cancer
Melanoma
Choline metabolism in cancer

Reactome:

Signaling by PDGF

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CERVICAL CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CERVICAL CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG ADENOCARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MESOTHELIOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PDGFC-related disorder	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TOOTH DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Angiomyolipoma of kidney	Angiomyolipoma Of Kidney	BEFREE	18988705		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	29410092		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	29410092		★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	37291580	Associate	★☆☆☆☆ Found in Text Mining only
Blood Platelet Disorders	Platelet disorder	Pubtator	26367242	Associate	★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Brain ischemia	Pubtator	25849290	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	22035541, 22939885, 24421315, 25383675, 26708018		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	22939885	Inhibit	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	25383675	Stimulate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	26456994, 31542979	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	28965749, 29410092, 31739742		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	31739742	Stimulate	★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	Pubtator	36359873	Associate	★☆☆☆☆ Found in Text Mining only
Cleft Lip	Cleft lip	Pubtator	19092777, 23029525	Associate	★☆☆☆☆ Found in Text Mining only
Cleft Lip with or without Cleft Palate	Cleft Lip With Or Without Cleft Palate	BEFREE	19092777		★☆☆☆☆ Found in Text Mining only
Cleft Palate	Cleft palate	Pubtator	19092777, 19401770	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	26537064		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	26537064	Stimulate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	35991839	Associate	★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	18588873		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	25849290	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	31739742	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Angiopathies	Diabetic angiopathies	Pubtator	25849290	Associate	★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	15728360, 24269585, 26122702		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	Pubtator	19366796, 33603171	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	31482267		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	38167429	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	31482267		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	20018898	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	BEFREE	20489153		★☆☆☆☆ Found in Text Mining only
Hepatocellular Adenoma	Hepatocellular adenoma	BEFREE	15728360		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	25849290	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	30827511		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	15911618	Inhibit	★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	12707385		★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	15374976		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	37291580	Associate	★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	15374708	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	15728360, 23929039, 26122702		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	16675559		★☆☆☆☆ Found in Text Mining only
Lymphangioleiomyomatosis	Lymphangiomyomatosis	BEFREE	18988705		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	25383675	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	31542979	Stimulate	★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	28260899		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant neoplasm of breast	Breast Cancer	BEFREE	22035541, 22939885, 24421315, 25383675, 26708018		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	23587162, 25383675, 28927050		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	LHGDN	12176024		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	24126726, 28977999		★☆☆☆☆ Found in Text Mining only
Membranous glomerulonephritis	Membranous Glomerulonephritis	BEFREE	12707385		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	CTD_human_DG	15920167		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mesothelioma Malignant	Mesothelioma	Pubtator	15920167	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11313995, 15920167, 16675559, 19118022, 22035541, 22362252, 23587162, 24126726, 24421315, 26122702, 28927050, 30563292		★☆☆☆☆ Found in Text Mining only
Orofacial Cleft 1	Orofacial cleft	Pubtator	23029525	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	21118967	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	35422475	Associate	★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	16443219		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	39253602	Associate	★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	18588873		★☆☆☆☆ Found in Text Mining only
Renal glomerular disease	Renal Glomerular Disease	BEFREE	12707385		★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	19366796		★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	Pubtator	19366796	Associate	★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	15728360, 26122702		★☆☆☆☆ Found in Text Mining only
Thrombotic Microangiopathies	Thrombotic Microangiopathies	BEFREE	20489153		★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	19968886	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	29410092		★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	36901825	Associate	★☆☆☆☆ Found in Text Mining only
Vitreoretinopathy Proliferative	Vitreoretinopathy	Pubtator	19032953	Associate	★☆☆☆☆ Found in Text Mining only