Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	56033
Gene name	BARX homeobox 1
Gene symbol	BARX1
Synonyms (NCBI Gene)	-
Chromosome	9
Chromosome location	9q22.32
Summary	This gene encodes a member of the Bar subclass of homeobox transcription factors. Studies of the mouse and chick homolog suggest the encoded protein may play a role in developing teeth and craniofacial mesenchyme of neural crest origin. The protein may al

Show/Hide all (45)

miRTarBase ID	miRNA	Experiments	Reference
MIRT022812	hsa-miR-124-3p	Microarray	18668037
MIRT500192	hsa-miR-4781-5p	PAR-CLIP	20371350
MIRT500191	hsa-miR-151a-5p	PAR-CLIP	20371350
MIRT500190	hsa-miR-151b	PAR-CLIP	20371350
MIRT500189	hsa-miR-744-5p	PAR-CLIP	20371350
MIRT500188	hsa-miR-1268a	PAR-CLIP	20371350
MIRT500187	hsa-miR-1268b	PAR-CLIP	20371350
MIRT500186	hsa-miR-6511b-5p	PAR-CLIP	20371350
MIRT500185	hsa-miR-6811-5p	PAR-CLIP	20371350
MIRT500192	hsa-miR-4781-5p	PAR-CLIP	24398324
MIRT500191	hsa-miR-151a-5p	PAR-CLIP	24398324
MIRT500190	hsa-miR-151b	PAR-CLIP	24398324
MIRT500189	hsa-miR-744-5p	PAR-CLIP	24398324
MIRT500188	hsa-miR-1268a	PAR-CLIP	24398324
MIRT500187	hsa-miR-1268b	PAR-CLIP	24398324
MIRT500186	hsa-miR-6511b-5p	PAR-CLIP	24398324
MIRT500185	hsa-miR-6811-5p	PAR-CLIP	24398324
MIRT500192	hsa-miR-4781-5p	PAR-CLIP	20371350
MIRT500191	hsa-miR-151a-5p	PAR-CLIP	20371350
MIRT500190	hsa-miR-151b	PAR-CLIP	20371350
MIRT500189	hsa-miR-744-5p	PAR-CLIP	20371350
MIRT500188	hsa-miR-1268a	PAR-CLIP	20371350
MIRT500187	hsa-miR-1268b	PAR-CLIP	20371350
MIRT500186	hsa-miR-6511b-5p	PAR-CLIP	20371350
MIRT500185	hsa-miR-6811-5p	PAR-CLIP	20371350
MIRT500192	hsa-miR-4781-5p	PAR-CLIP	24398324
MIRT500191	hsa-miR-151a-5p	PAR-CLIP	24398324
MIRT500190	hsa-miR-151b	PAR-CLIP	24398324
MIRT500189	hsa-miR-744-5p	PAR-CLIP	24398324
MIRT500188	hsa-miR-1268a	PAR-CLIP	24398324
MIRT500187	hsa-miR-1268b	PAR-CLIP	24398324
MIRT500186	hsa-miR-6511b-5p	PAR-CLIP	24398324
MIRT500185	hsa-miR-6811-5p	PAR-CLIP	24398324
MIRT815913	hsa-miR-1225-3p	CLIP-seq
MIRT815914	hsa-miR-1233	CLIP-seq
MIRT815915	hsa-miR-2467-5p	CLIP-seq
MIRT815916	hsa-miR-3612	CLIP-seq
MIRT815917	hsa-miR-3616-3p	CLIP-seq
MIRT815918	hsa-miR-4254	CLIP-seq
MIRT815919	hsa-miR-4436b-3p	CLIP-seq
MIRT815920	hsa-miR-4443	CLIP-seq
MIRT815921	hsa-miR-4476	CLIP-seq
MIRT815922	hsa-miR-4707-5p	CLIP-seq
MIRT815923	hsa-miR-4728-5p	CLIP-seq
MIRT815924	hsa-miR-650	CLIP-seq

Show/Hide all (20)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	NAS	10995576
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0007267	Process	Cell-cell signaling	IEA
GO:0009888	Process	Tissue development	IEA
GO:0009952	Process	Anterior/posterior pattern specification	IEA
GO:0016055	Process	Wnt signaling pathway	IEA
GO:0030178	Process	Negative regulation of Wnt signaling pathway	IEA
GO:0045446	Process	Endothelial cell differentiation	IEA
GO:0048513	Process	Animal organ development	IEA
GO:0048536	Process	Spleen development	IEA
GO:0055123	Process	Digestive system development	IEA

MIM	HGNC	e!Ensembl
603260	955	ENSG00000131668

Q9HBU1

Protein name

Homeobox protein BarH-like 1

Protein function

Transcription factor, which is involved in craniofacial development, in odontogenesis and in stomach organogenesis. May have a role in the differentiation of molars from incisors. Plays a role in suppressing endodermal Wnt activity (By similarit

PDB

2DMT

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00046	Homeodomain	143 → 199	Homeodomain	Domain

Tissue specificity

TISSUE SPECIFICITY: Widely expressed. Expressed at higher levels in testis and heart. Detected in craniofacial tissue and adult iris, but not in lymphocytes, fibroblasts, choroid retina, retinal pigment epithelium, kidney, or fetal liver.

Sequence

MQRPGEPGAARFGPPEGCADHRPHRYRSFMIEEILTEPPGPKGAAPAAAAAAAGELLKFG
VQALLAARPFHSHLAVLKAEQAAVFKFPLAPLGCSGLSSALLAAGPGLPGAAGAPHLPLE
LQLRGKLEAAGPGEPGTKAKKGRRSRTVFTELQLMGLEKRFEKQKYLSTPDRIDLAESLG
LSQLQVKTWYQNRRMKWKKIVLQGGGLESPTKPKGRPKKNSIPTSEQLTEQERAKDAEKP
AEVPGEPSDRSRED

Sequence length

254

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BARRETT'S ESOPHAGUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIGESTIVE SYSTEM DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL ADENOCARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PEPTIC ULCER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (20)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma Of Esophagus	Esophageal Cancer	GWASDB_DG	24121790		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma Of Esophagus	Esophageal Cancer	CTD_human_DG	24121790		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma Of Esophagus	Esophageal Cancer	GWASCAT_DG	24121790		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma Of Esophagus	Esophageal Cancer	BEFREE	25447851, 26383589, 29454095		★★★★★ ★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	GWASCAT_DG	24121790		★★★★★ ★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	25447851	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cleft Lip	Cleft lip	Pubtator	18708738	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Digestive System Disorders	Digestive System Disorders	GWASCAT_DG	24121790		★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial multiple trichoepitheliomata	Multiple Trichoepithelioma	BEFREE	26383589		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastroesophageal reflux disease	Gastroesophageal Reflux Disease	BEFREE	31048564		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Diseases	Gastrointestinal Diseases	GWASCAT_DG	24121790		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	Pubtator	33451979	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal Diseases	GWASCAT_DG	24121790		★★★★★ ★☆☆☆☆ Found in Text Mining only
IRIDOGONIODYSGENESIS, TYPE 2	Anterior segment dysgenesis	BEFREE	10995576		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	29069753		★★★★★ ★☆☆☆☆ Found in Text Mining only
Microstomia	Microstomia	BEFREE	27756109		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	36927457	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pyloric Stenosis, Hypertrophic	Congenital hypertrophic pyloric stenosis	BEFREE	30281099		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhinitis Allergic	Rhinitis	Pubtator	35133179	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	29454095		★★★★★ ★☆☆☆☆ Found in Text Mining only

BARX1 (BARX homeobox 1)