MAPK10 (mitogen-activated protein kinase 10)

Gene

• Entrez ID: 5602
• Gene name: Mitogen-activated protein kinase 10
• Gene symbol: MAPK10
• Synonyms (NCBI Gene): JNK3, JNK3A, PRKM10, SAPK1b, p493F12, p54bSAPK
• Chromosome: 4
• Chromosome location: 4q21.3
• Summary: The protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as integration points for multiple biochemical signals, and thus are involved in a wide variety of cellular processes, such as proliferation, differentiation, transcrip

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT053727	hsa-miR-221-3p	Microarray	22942087
MIRT667467	hsa-miR-3617-5p	HITS-CLIP	23824327
MIRT667466	hsa-miR-641	HITS-CLIP	23824327
MIRT607689	hsa-miR-6867-5p	HITS-CLIP	23824327
MIRT667465	hsa-miR-3152-3p	HITS-CLIP	23824327
MIRT667464	hsa-miR-208a-3p	HITS-CLIP	23824327
MIRT667463	hsa-miR-208b-3p	HITS-CLIP	23824327
MIRT667462	hsa-miR-499a-5p	HITS-CLIP	23824327
MIRT607691	hsa-miR-4455	HITS-CLIP	23824327
MIRT607680	hsa-miR-574-5p	HITS-CLIP	23824327
MIRT607697	hsa-miR-5002-5p	HITS-CLIP	24906430
MIRT607696	hsa-miR-342-5p	HITS-CLIP	24906430
MIRT607695	hsa-miR-4664-5p	HITS-CLIP	24906430
MIRT607694	hsa-miR-4651	HITS-CLIP	24906430
MIRT607693	hsa-miR-608	HITS-CLIP	24906430
MIRT607692	hsa-miR-6747-5p	HITS-CLIP	24906430
MIRT607691	hsa-miR-4455	HITS-CLIP	24906430
MIRT607690	hsa-miR-3650	HITS-CLIP	24906430
MIRT607689	hsa-miR-6867-5p	HITS-CLIP	24906430
MIRT607688	hsa-miR-6737-5p	HITS-CLIP	24906430
MIRT607687	hsa-miR-6812-5p	HITS-CLIP	24906430
MIRT607686	hsa-miR-6819-5p	HITS-CLIP	24906430
MIRT607685	hsa-miR-3170	HITS-CLIP	24906430
MIRT607684	hsa-miR-6855-5p	HITS-CLIP	24906430
MIRT607683	hsa-miR-450a-2-3p	HITS-CLIP	24906430
MIRT607682	hsa-miR-4260	HITS-CLIP	24906430
MIRT607681	hsa-miR-5572	HITS-CLIP	24906430
MIRT607680	hsa-miR-574-5p	HITS-CLIP	24906430
MIRT667464	hsa-miR-208a-3p	HITS-CLIP	27418678
MIRT667463	hsa-miR-208b-3p	HITS-CLIP	27418678
MIRT667465	hsa-miR-3152-3p	HITS-CLIP	27418678
MIRT667465	hsa-miR-3152-3p	HITS-CLIP	27418678
MIRT667465	hsa-miR-3152-3p	HITS-CLIP	27418678
MIRT607685	hsa-miR-3170	HITS-CLIP	27418678
MIRT607685	hsa-miR-3170	HITS-CLIP	27418678
MIRT607696	hsa-miR-342-5p	HITS-CLIP	27418678
MIRT607696	hsa-miR-342-5p	HITS-CLIP	27418678
MIRT667467	hsa-miR-3617-5p	HITS-CLIP	27418678
MIRT607690	hsa-miR-3650	HITS-CLIP	27418678
MIRT607690	hsa-miR-3650	HITS-CLIP	27418678
MIRT607682	hsa-miR-4260	HITS-CLIP	27418678
MIRT607682	hsa-miR-4260	HITS-CLIP	27418678
MIRT607691	hsa-miR-4455	HITS-CLIP	27418678
MIRT607691	hsa-miR-4455	HITS-CLIP	27418678
MIRT607691	hsa-miR-4455	HITS-CLIP	27418678
MIRT607683	hsa-miR-450a-2-3p	HITS-CLIP	27418678
MIRT607683	hsa-miR-450a-2-3p	HITS-CLIP	27418678
MIRT607694	hsa-miR-4651	HITS-CLIP	27418678
MIRT607694	hsa-miR-4651	HITS-CLIP	27418678
MIRT607695	hsa-miR-4664-5p	HITS-CLIP	27418678
MIRT607695	hsa-miR-4664-5p	HITS-CLIP	27418678
MIRT667462	hsa-miR-499a-5p	HITS-CLIP	27418678
MIRT607697	hsa-miR-5002-5p	HITS-CLIP	27418678
MIRT607697	hsa-miR-5002-5p	HITS-CLIP	27418678
MIRT607681	hsa-miR-5572	HITS-CLIP	27418678
MIRT607681	hsa-miR-5572	HITS-CLIP	27418678
MIRT607680	hsa-miR-574-5p	HITS-CLIP	27418678
MIRT607680	hsa-miR-574-5p	HITS-CLIP	27418678
MIRT607680	hsa-miR-574-5p	HITS-CLIP	27418678
MIRT607693	hsa-miR-608	HITS-CLIP	27418678
MIRT607693	hsa-miR-608	HITS-CLIP	27418678
MIRT667466	hsa-miR-641	HITS-CLIP	27418678
MIRT607688	hsa-miR-6737-5p	HITS-CLIP	27418678
MIRT607688	hsa-miR-6737-5p	HITS-CLIP	27418678
MIRT607692	hsa-miR-6747-5p	HITS-CLIP	27418678
MIRT607692	hsa-miR-6747-5p	HITS-CLIP	27418678
MIRT607687	hsa-miR-6812-5p	HITS-CLIP	27418678
MIRT607687	hsa-miR-6812-5p	HITS-CLIP	27418678
MIRT607686	hsa-miR-6819-5p	HITS-CLIP	27418678
MIRT607686	hsa-miR-6819-5p	HITS-CLIP	27418678
MIRT607684	hsa-miR-6855-5p	HITS-CLIP	27418678
MIRT607684	hsa-miR-6855-5p	HITS-CLIP	27418678
MIRT607689	hsa-miR-6867-5p	HITS-CLIP	27418678
MIRT607689	hsa-miR-6867-5p	HITS-CLIP	27418678
MIRT607689	hsa-miR-6867-5p	HITS-CLIP	27418678
MIRT733960	hsa-miR-205-3p	Luciferase reporter assay, Western blotting	32046433
MIRT667467	hsa-miR-3617-5p	HITS-CLIP	23824327
MIRT667466	hsa-miR-641	HITS-CLIP	23824327
MIRT607689	hsa-miR-6867-5p	HITS-CLIP	23824327
MIRT667465	hsa-miR-3152-3p	HITS-CLIP	23824327
MIRT667464	hsa-miR-208a-3p	HITS-CLIP	23824327
MIRT667463	hsa-miR-208b-3p	HITS-CLIP	23824327
MIRT667462	hsa-miR-499a-5p	HITS-CLIP	23824327
MIRT607691	hsa-miR-4455	HITS-CLIP	23824327
MIRT607680	hsa-miR-574-5p	HITS-CLIP	23824327
MIRT1130045	hsa-miR-124	CLIP-seq
MIRT1130046	hsa-miR-2682	CLIP-seq
MIRT1130047	hsa-miR-3714	CLIP-seq
MIRT1130048	hsa-miR-3910	CLIP-seq
MIRT1130049	hsa-miR-4328	CLIP-seq
MIRT1130050	hsa-miR-4477b	CLIP-seq
MIRT1130051	hsa-miR-449c	CLIP-seq
MIRT1130052	hsa-miR-4795-3p	CLIP-seq
MIRT1130053	hsa-miR-506	CLIP-seq
MIRT1130054	hsa-miR-197	CLIP-seq
MIRT1130055	hsa-miR-3977	CLIP-seq
MIRT1130056	hsa-miR-412	CLIP-seq
MIRT1130057	hsa-miR-4252	CLIP-seq
MIRT1130058	hsa-miR-4722-3p	CLIP-seq
MIRT1130059	hsa-miR-1256	CLIP-seq
MIRT738743	hsa-miR-1273g	CLIP-seq
MIRT738741	hsa-miR-1275	CLIP-seq
MIRT738745	hsa-miR-342-3p	CLIP-seq
MIRT1130060	hsa-miR-3942-3p	CLIP-seq
MIRT738744	hsa-miR-4318	CLIP-seq
MIRT1130049	hsa-miR-4328	CLIP-seq
MIRT738742	hsa-miR-4665-5p	CLIP-seq
MIRT1130061	hsa-miR-4720-5p	CLIP-seq
MIRT1130062	hsa-miR-4799-3p	CLIP-seq
MIRT738743	hsa-miR-1273g	CLIP-seq
MIRT738741	hsa-miR-1275	CLIP-seq
MIRT738745	hsa-miR-342-3p	CLIP-seq
MIRT738744	hsa-miR-4318	CLIP-seq
MIRT738742	hsa-miR-4665-5p	CLIP-seq
MIRT2037034	hsa-miR-562	CLIP-seq
MIRT2267079	hsa-miR-1197	CLIP-seq
MIRT2267080	hsa-miR-1224-5p	CLIP-seq
MIRT2267081	hsa-miR-1233	CLIP-seq
MIRT2267082	hsa-miR-125a-5p	CLIP-seq
MIRT2267083	hsa-miR-125b	CLIP-seq
MIRT2267084	hsa-miR-193a-3p	CLIP-seq
MIRT2267085	hsa-miR-193b	CLIP-seq
MIRT2267086	hsa-miR-2052	CLIP-seq
MIRT2267087	hsa-miR-21	CLIP-seq
MIRT2267088	hsa-miR-2110	CLIP-seq
MIRT2267089	hsa-miR-3128	CLIP-seq
MIRT2267090	hsa-miR-3137	CLIP-seq
MIRT2267091	hsa-miR-3150a-3p	CLIP-seq
MIRT2267092	hsa-miR-3185	CLIP-seq
MIRT2267093	hsa-miR-3194-3p	CLIP-seq
MIRT2267094	hsa-miR-3529	CLIP-seq
MIRT2267095	hsa-miR-3660	CLIP-seq
MIRT2267096	hsa-miR-3686	CLIP-seq
MIRT2267097	hsa-miR-379	CLIP-seq
MIRT2267098	hsa-miR-4319	CLIP-seq
MIRT2267099	hsa-miR-4450	CLIP-seq
MIRT2267100	hsa-miR-4451	CLIP-seq
MIRT2267101	hsa-miR-4526	CLIP-seq
MIRT2267102	hsa-miR-4643	CLIP-seq
MIRT2267103	hsa-miR-4645-3p	CLIP-seq
MIRT2267104	hsa-miR-4650-3p	CLIP-seq
MIRT2267105	hsa-miR-4732-5p	CLIP-seq
MIRT2267106	hsa-miR-4751	CLIP-seq
MIRT2267107	hsa-miR-544b	CLIP-seq
MIRT2267108	hsa-miR-590-5p	CLIP-seq
MIRT2267109	hsa-miR-629	CLIP-seq
MIRT2267110	hsa-miR-642b	CLIP-seq
MIRT2267111	hsa-miR-656	CLIP-seq
MIRT2267112	hsa-miR-892b	CLIP-seq
MIRT738743	hsa-miR-1273g	CLIP-seq
MIRT738741	hsa-miR-1275	CLIP-seq
MIRT738745	hsa-miR-342-3p	CLIP-seq
MIRT738744	hsa-miR-4318	CLIP-seq
MIRT738742	hsa-miR-4665-5p	CLIP-seq
MIRT2453701	hsa-miR-2113	CLIP-seq
MIRT2453702	hsa-miR-3926	CLIP-seq
MIRT2453703	hsa-miR-4493	CLIP-seq
MIRT2453704	hsa-miR-4753-5p	CLIP-seq
MIRT2453705	hsa-miR-550a	CLIP-seq
MIRT2566944	hsa-miR-1193	CLIP-seq
MIRT2566945	hsa-miR-1228	CLIP-seq
MIRT2566946	hsa-miR-1287	CLIP-seq
MIRT2566947	hsa-miR-1301	CLIP-seq
MIRT2566948	hsa-miR-3135b	CLIP-seq
MIRT2566949	hsa-miR-3148	CLIP-seq
MIRT2566950	hsa-miR-3160-5p	CLIP-seq
MIRT2566951	hsa-miR-345	CLIP-seq
MIRT2566952	hsa-miR-3675-3p	CLIP-seq
MIRT2566953	hsa-miR-3675-5p	CLIP-seq
MIRT2566954	hsa-miR-3688-3p	CLIP-seq
MIRT2566955	hsa-miR-3920	CLIP-seq
MIRT2566956	hsa-miR-3927	CLIP-seq
MIRT1130057	hsa-miR-4252	CLIP-seq
MIRT2566957	hsa-miR-4282	CLIP-seq
MIRT2566958	hsa-miR-4436b-3p	CLIP-seq
MIRT2566959	hsa-miR-4473	CLIP-seq
MIRT2566960	hsa-miR-450b-5p	CLIP-seq
MIRT2267102	hsa-miR-4643	CLIP-seq
MIRT2267103	hsa-miR-4645-3p	CLIP-seq
MIRT2566961	hsa-miR-4684-5p	CLIP-seq
MIRT2566962	hsa-miR-4696	CLIP-seq
MIRT2566963	hsa-miR-4711-3p	CLIP-seq
MIRT2566964	hsa-miR-4717-5p	CLIP-seq
MIRT2566965	hsa-miR-4718	CLIP-seq
MIRT2566966	hsa-miR-4735-5p	CLIP-seq
MIRT2566967	hsa-miR-4742-3p	CLIP-seq
MIRT2566968	hsa-miR-5047	CLIP-seq
MIRT2566969	hsa-miR-507	CLIP-seq
MIRT2566970	hsa-miR-5095	CLIP-seq
MIRT2566971	hsa-miR-512-3p	CLIP-seq
MIRT2566972	hsa-miR-520f	CLIP-seq
MIRT2566973	hsa-miR-552	CLIP-seq
MIRT2566974	hsa-miR-557	CLIP-seq
MIRT2037034	hsa-miR-562	CLIP-seq
MIRT2566975	hsa-miR-592	CLIP-seq
MIRT2566976	hsa-miR-599	CLIP-seq
MIRT2267110	hsa-miR-642b	CLIP-seq
MIRT2566977	hsa-miR-935	CLIP-seq
MIRT2566978	hsa-miR-942	CLIP-seq
MIRT2566944	hsa-miR-1193	CLIP-seq
MIRT2566945	hsa-miR-1228	CLIP-seq
MIRT2566946	hsa-miR-1287	CLIP-seq
MIRT2566947	hsa-miR-1301	CLIP-seq
MIRT2566948	hsa-miR-3135b	CLIP-seq
MIRT2566949	hsa-miR-3148	CLIP-seq
MIRT2566951	hsa-miR-345	CLIP-seq
MIRT2566952	hsa-miR-3675-3p	CLIP-seq
MIRT2566953	hsa-miR-3675-5p	CLIP-seq
MIRT2566954	hsa-miR-3688-3p	CLIP-seq
MIRT2684570	hsa-miR-377	CLIP-seq
MIRT2453702	hsa-miR-3926	CLIP-seq
MIRT2566956	hsa-miR-3927	CLIP-seq
MIRT2684571	hsa-miR-3976	CLIP-seq
MIRT1130057	hsa-miR-4252	CLIP-seq
MIRT2566957	hsa-miR-4282	CLIP-seq
MIRT2684572	hsa-miR-4297	CLIP-seq
MIRT2684573	hsa-miR-4432	CLIP-seq
MIRT2566958	hsa-miR-4436b-3p	CLIP-seq
MIRT2566959	hsa-miR-4473	CLIP-seq
MIRT2453703	hsa-miR-4493	CLIP-seq
MIRT2566960	hsa-miR-450b-5p	CLIP-seq
MIRT2267102	hsa-miR-4643	CLIP-seq
MIRT2267103	hsa-miR-4645-3p	CLIP-seq
MIRT2684574	hsa-miR-4662a-3p	CLIP-seq
MIRT2566961	hsa-miR-4684-5p	CLIP-seq
MIRT2566962	hsa-miR-4696	CLIP-seq
MIRT2566963	hsa-miR-4711-3p	CLIP-seq
MIRT2566964	hsa-miR-4717-5p	CLIP-seq
MIRT2566965	hsa-miR-4718	CLIP-seq
MIRT2566966	hsa-miR-4735-5p	CLIP-seq
MIRT2566967	hsa-miR-4742-3p	CLIP-seq
MIRT2453704	hsa-miR-4753-5p	CLIP-seq
MIRT2566968	hsa-miR-5047	CLIP-seq
MIRT2566969	hsa-miR-507	CLIP-seq
MIRT2566970	hsa-miR-5095	CLIP-seq
MIRT2566971	hsa-miR-512-3p	CLIP-seq
MIRT2566972	hsa-miR-520f	CLIP-seq
MIRT2684575	hsa-miR-548u	CLIP-seq
MIRT2566973	hsa-miR-552	CLIP-seq
MIRT2566974	hsa-miR-557	CLIP-seq
MIRT2037034	hsa-miR-562	CLIP-seq
MIRT2566975	hsa-miR-592	CLIP-seq
MIRT2566976	hsa-miR-599	CLIP-seq
MIRT2267110	hsa-miR-642b	CLIP-seq
MIRT2566977	hsa-miR-935	CLIP-seq
MIRT2566978	hsa-miR-942	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000165	Process	MAPK cascade	IEA
GO:0000166	Function	Nucleotide binding	IEA
GO:0004672	Function	Protein kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004705	Function	JUN kinase activity	IBA
GO:0004705	Function	JUN kinase activity	ISS	8654373
GO:0004705	Function	JUN kinase activity	TAS	8654373
GO:0004707	Function	MAP kinase activity	IEA
GO:0004708	Function	MAP kinase kinase activity	TAS	7826642
GO:0005515	Function	Protein binding	IPI	19294699, 19527717, 19782076, 19879840, 21988832, 22327296, 33961781
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0005739	Component	Mitochondrion	IEA
GO:0005739	Component	Mitochondrion	ISS
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	ISS
GO:0006468	Process	Protein phosphorylation	IMP	22441692
GO:0006468	Process	Protein phosphorylation	ISS
GO:0007165	Process	Signal transduction	TAS	8654373
GO:0007254	Process	JNK cascade	IBA
GO:0007254	Process	JNK cascade	ISS	8654373
GO:0009416	Process	Response to light stimulus	ISS
GO:0016020	Component	Membrane	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0038095	Process	Fc-epsilon receptor signaling pathway	IEA
GO:0038095	Process	Fc-epsilon receptor signaling pathway	TAS
GO:0042752	Process	Regulation of circadian rhythm	ISS
GO:0048511	Process	Rhythmic process	IEA
GO:0090398	Process	Cellular senescence	IEA
GO:0090398	Process	Cellular senescence	TAS
GO:0106310	Function	Protein serine kinase activity	IEA

Other IDs

• MIM: 602897
• HGNC: 6872
• e!Ensembl: ENSG00000109339

Protein

• UniProt ID: P53779
• Protein name: Mitogen-activated protein kinase 10 (MAP kinase 10) (MAPK 10) (EC 2.7.11.24) (MAP kinase p49 3F12) (Stress-activated protein kinase 1b) (SAPK1b) (Stress-activated protein kinase JNK3) (c-Jun N-terminal kinase 3)
• Protein function: Serine/threonine-protein kinase involved in various processes such as neuronal proliferation, differentiation, migration and programmed cell death. Extracellular stimuli such as pro-inflammatory cytokines or physical stress stimulate the stress-
• PDB: 1JNK, 1PMN, 1PMU, 1PMV, 2B1P, 2EXC, 2O0U, 2O2U, 2OK1, 2P33, 2R9S, 2WAJ, 2ZDT, 2ZDU, 3CGF, 3CGO, 3DA6, 3FI2, 3FI3, 3FV8, 3G90, 3G9L, 3G9N, 3KVX, 3OXI, 3OY1, 3PTG, 3RTP, 3TTI, 3TTJ, 3V6R, 3V6S, 4H36, 4H39, 4H3B, 4KKE, 4KKG, 4KKH, 4U79, 4W4V, 4W4W, 4W4X, 4W4Y, 4WHZ, 4X21, 4Y46, 4Y5H, 4Z9L, 6EKD, 6EMH, 6EQ9
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00069	Pkinase	64 → 359	Protein kinase domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Specific to a subset of neurons in the nervous system. Present in the hippocampus and areas, cerebellum, striatum, brain stem, and weakly in the spinal cord. Very weak expression in testis and kidney.
• Sequence:

  MSLHFLYYCSEPTLDVKIAFCQGFDKQVDVSYIAKHYNMSKSKVDNQFYSVEVGDSTFTV
  LKRYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNH
  KNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIQMELDHERMSYLLYQMLCGIKHL
  HSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILGMGY
  KENVDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIEQLGTPCPEFMKKLQPTVRNYVEN
  RPKYAGLTFPKLFPDSLFPADSEHNKLKASQARDLLSKMLVIDPAKRISVDDALQHPYIN
  VWYDPAEVEAPPPQIYDKQLDEREHTIEEWKELIYKEVMNSEEKTKNGVVKGQPSPSGAA
  VNSSESLPPSSSVNDISSMSTDQTLASDTDSSLEASAGPLGCCR

• Sequence length: 464

Pathways

KEGG:

Endocrine resistance
MAPK signaling pathway
ErbB signaling pathway
Ras signaling pathway
cAMP signaling pathway
FoxO signaling pathway
Sphingolipid signaling pathway
Mitophagy - animal
Autophagy - animal
Protein processing in endoplasmic reticulum
Apoptosis
Apoptosis - multiple species
Necroptosis
Wnt signaling pathway
Osteoclast differentiation
Focal adhesion
Tight junction
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
RIG-I-like receptor signaling pathway
C-type lectin receptor signaling pathway
IL-17 signaling pathway
Th1 and Th2 cell differentiation
Th17 cell differentiation
T cell receptor signaling pathway
Fc epsilon RI signaling pathway
TNF signaling pathway
Neurotrophin signaling pathway
Retrograde endocannabinoid signaling
Dopaminergic synapse
Inflammatory mediator regulation of TRP channels
Insulin signaling pathway
GnRH signaling pathway
Progesterone-mediated oocyte maturation
Prolactin signaling pathway
Adipocytokine signaling pathway
Relaxin signaling pathway
Type II diabetes mellitus
Insulin resistance
Non-alcoholic fatty liver disease
AGE-RAGE signaling pathway in diabetic complications
Growth hormone synthesis, secretion and action
Alcoholic liver disease
Alzheimer disease
Parkinson disease
Huntington disease
Spinocerebellar ataxia
Prion disease
Pathways of neurodegeneration - multiple diseases
Epithelial cell signaling in Helicobacter pylori infection
Pathogenic Escherichia coli infection
Shigellosis
Salmonella infection
Pertussis
Yersinia infection
Chagas disease
Toxoplasmosis
Tuberculosis
Hepatitis B
Measles
Human T-cell leukemia virus 1 infection
Kaposi sarcoma-associated herpesvirus infection
Epstein-Barr virus infection
Human immunodeficiency virus 1 infection
Coronavirus disease - COVID-19
Pathways in cancer
Chemical carcinogenesis - reactive oxygen species
Colorectal cancer
Pancreatic cancer
Choline metabolism in cancer
Diabetic cardiomyopathy
Lipid and atherosclerosis
Fluid shear stress and atherosclerosis

Reactome:

Oxidative Stress Induced Senescence
FCERI mediated MAPK activation
JNK (c-Jun kinases) phosphorylation and activation mediated by activated human TAK1
Activation of the AP-1 family of transcription factors

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
BREAST CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGESTIVE HEART FAILURE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Epileptic encephalopathy	Likely benign; Uncertain significance	ClinVar Disgenet	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Epileptic encephalopathy with cognitive deficit	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LENNOX-GASTAUT SYNDROME	—	Disgenet, GenCC, Orphanet Disgenet, GenCC, Orphanet Disgenet, GenCC, Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MACROCEPHALY AND EPILEPTIC ENCEPHALOPATHY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAPK10-related disorder	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL OR BEHAVIOURAL DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIGRAINE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OLIGODENDROGLIOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIPHERAL ARTERIAL DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostate cancer	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSYCHIATRIC DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TOURETTE SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Alzheimer Disease	Alzheimer disease	Pubtator	21811019, 37236204, 7826642	Associate	★☆☆☆☆ Found in Text Mining only
Anorexia	Anorexia	BEFREE	28165482		★☆☆☆☆ Found in Text Mining only
Atypical absence seizure	Absence Seizure	HPO_DG			★☆☆☆☆ Found in Text Mining only
Autistic behavior	Autism	HPO_DG			★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	11322657		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	31375553		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	30670769, 32947764	Associate	★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	12967475		★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	12967475	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	32987560	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	32572915	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	32119844	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	24767251		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	28007909		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	30412737		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	31849520		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	31849520		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	23329067		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	37236204	Stimulate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	29451183	Associate	★☆☆☆☆ Found in Text Mining only
Congenital Abnormalities	Congenital abnormalities	Pubtator	21712996	Associate	★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	30506715		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	37680885	Associate	★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	7826642		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	7826642	Associate	★☆☆☆☆ Found in Text Mining only
Encephalopathies	Epileptic encephalopathy	HPO_DG			★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	27814647		★☆☆☆☆ Found in Text Mining only
Epilepsy, Temporal Lobe	Epilepsy	BEFREE	28664455		★☆☆☆☆ Found in Text Mining only
Epileptic drop attack	Hypotonic seizures	HPO_DG			★☆☆☆☆ Found in Text Mining only
Epileptic encephalopathy	Epileptic encephalopathy	BEFREE	16249883		★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Epileptic encephalopathy	Epileptic encephalopathy	GENOMICS_ENGLAND_DG	23329067		★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Generalized myoclonic seizures	Myoclonic Seizures	HPO_DG			★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	BEFREE	29899326		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	18281515, 32987560	Associate	★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	Pubtator	35507738	Associate	★☆☆☆☆ Found in Text Mining only
Hirschsprung Disease	Hirschsprung disease	Pubtator	21712996, 32066630	Associate	★☆☆☆☆ Found in Text Mining only
Hirschsprung Disease	Hirschsprung Disease	BEFREE	27902697		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	19525941		★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	23329067		★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	HPO_DG			★☆☆☆☆ Found in Text Mining only
Keratocystic Odontogenic Tumor	Keratocystic Odontogenic Tumor	BEFREE	30811745		★☆☆☆☆ Found in Text Mining only
Langer-Giedion Syndrome	Langer-Giedion Syndrome	GENOMICS_ENGLAND_DG	23329067		★☆☆☆☆ Found in Text Mining only
Lennox-Gastaut syndrome	Lennox-Gastaut Syndrome	ORPHANET_DG	16249883		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lennox-Gastaut syndrome	Lennox-Gastaut Syndrome	Orphanet			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lennox-Gastaut syndrome	Lennox-Gastaut Syndrome	GENOMICS_ENGLAND_DG	23329067		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Leukemia, Myelocytic, Acute	Leukemia	GWASCAT_DG	27903959		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	20525557		★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	12967475	Associate	★☆☆☆☆ Found in Text Mining only
MACROCEPHALY AND EPILEPTIC ENCEPHALOPATHY	MACROCEPHALY AND EPILEPTIC ENCEPHALOPATHY	GENOMICS_ENGLAND_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant neoplasm of breast	Breast Cancer	BEFREE	31375553		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	24767251		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	31849520		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	22958823		★☆☆☆☆ Found in Text Mining only
Microphthalmos	Microphthalmos	BEFREE	25807892		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	36289430	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	28011860		★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	BEFREE	28007909		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	28393229	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	12734425		★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	29930333		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	31432180		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	31432180	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	26505831, 28372912, 28676395, 31158642, 31268308		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	28165482, 28180059		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	37285835	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	24767251		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	25044439, 33004058, 37095524	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	38330578	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	29257285, 30783448		★☆☆☆☆ Found in Text Mining only
Personality Disorders	Personality Disorders	HPO_DG			★☆☆☆☆ Found in Text Mining only
Pulmonary edema of mountaineers	Pulmonary edema	Pubtator	24465776	Associate	★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	31037574		★☆☆☆☆ Found in Text Mining only
Spinal Muscular Atrophy	Spinal Muscular Atrophy	BEFREE	26423457		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	35974187	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	23409748		★☆☆☆☆ Found in Text Mining only
Status Epilepticus	Status Epilepticus	BEFREE	28664455		★☆☆☆☆ Found in Text Mining only
Tonic - clonic seizures	Seizure	HPO_DG			★☆☆☆☆ Found in Text Mining only
WHIM syndrome	Whim syndrome	Pubtator	33485325	Associate	★☆☆☆☆ Found in Text Mining only