Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	55971
Gene name	BAR/IMD domain containing adaptor protein 2 like 1
Gene symbol	BAIAP2L1
Synonyms (NCBI Gene)	IRTKS
Chromosome	7
Chromosome location	7q21.3-q22.1
Summary	This gene encodes a member of the IMD (IRSp53/MIM homology domain) family. Members of this family can be subdivided in two groups, the IRSp53-like and MIM-like, based on the presence or absence of the SH3 (Src homology 3) domain. The protein encoded by th

156

Show/Hide all (156)

miRTarBase ID	miRNA	Experiments
MIRT740076	hsa-miR-1184	CLIP-seq
MIRT815516	hsa-miR-1205	CLIP-seq
MIRT815517	hsa-miR-1250	CLIP-seq
MIRT815518	hsa-miR-1262	CLIP-seq
MIRT815519	hsa-miR-1297	CLIP-seq
MIRT815520	hsa-miR-151-3p	CLIP-seq
MIRT815521	hsa-miR-1827	CLIP-seq
MIRT815522	hsa-miR-188-5p	CLIP-seq
MIRT740074	hsa-miR-205	CLIP-seq
MIRT815523	hsa-miR-2054	CLIP-seq
MIRT815524	hsa-miR-216a	CLIP-seq
MIRT815525	hsa-miR-2278	CLIP-seq
MIRT815526	hsa-miR-26a	CLIP-seq
MIRT815527	hsa-miR-26b	CLIP-seq
MIRT740075	hsa-miR-3127-3p	CLIP-seq
MIRT815528	hsa-miR-3145-3p	CLIP-seq
MIRT815529	hsa-miR-3148	CLIP-seq
MIRT815530	hsa-miR-3158-5p	CLIP-seq
MIRT815531	hsa-miR-3160-3p	CLIP-seq
MIRT815532	hsa-miR-3170	CLIP-seq
MIRT815533	hsa-miR-3192	CLIP-seq
MIRT815534	hsa-miR-3612	CLIP-seq
MIRT815535	hsa-miR-3659	CLIP-seq
MIRT815536	hsa-miR-3663-5p	CLIP-seq
MIRT815537	hsa-miR-3665	CLIP-seq
MIRT815538	hsa-miR-3689a-3p	CLIP-seq
MIRT815539	hsa-miR-3689c	CLIP-seq
MIRT815540	hsa-miR-3714	CLIP-seq
MIRT815541	hsa-miR-382	CLIP-seq
MIRT815542	hsa-miR-4269	CLIP-seq
MIRT815543	hsa-miR-4314	CLIP-seq
MIRT740071	hsa-miR-4447	CLIP-seq
MIRT815544	hsa-miR-4457	CLIP-seq
MIRT815545	hsa-miR-4465	CLIP-seq
MIRT740070	hsa-miR-4472	CLIP-seq
MIRT815546	hsa-miR-4477a	CLIP-seq
MIRT815547	hsa-miR-4477b	CLIP-seq
MIRT815548	hsa-miR-4484	CLIP-seq
MIRT815549	hsa-miR-4487	CLIP-seq
MIRT815550	hsa-miR-4490	CLIP-seq
MIRT815551	hsa-miR-4527	CLIP-seq
MIRT815552	hsa-miR-4532	CLIP-seq
MIRT815553	hsa-miR-4646-5p	CLIP-seq
MIRT815554	hsa-miR-4658	CLIP-seq
MIRT815555	hsa-miR-4663	CLIP-seq
MIRT815556	hsa-miR-4690-5p	CLIP-seq
MIRT815557	hsa-miR-4699-3p	CLIP-seq
MIRT815558	hsa-miR-4701-3p	CLIP-seq
MIRT815559	hsa-miR-4728-5p	CLIP-seq
MIRT815560	hsa-miR-4729	CLIP-seq
MIRT815561	hsa-miR-4731-3p	CLIP-seq
MIRT815562	hsa-miR-4760-3p	CLIP-seq
MIRT740077	hsa-miR-4763-5p	CLIP-seq
MIRT815563	hsa-miR-4772-3p	CLIP-seq
MIRT815564	hsa-miR-4780	CLIP-seq
MIRT815565	hsa-miR-4792	CLIP-seq
MIRT815566	hsa-miR-4795-3p	CLIP-seq
MIRT815567	hsa-miR-4797-5p	CLIP-seq
MIRT815568	hsa-miR-4801	CLIP-seq
MIRT815569	hsa-miR-490-3p	CLIP-seq
MIRT740072	hsa-miR-541	CLIP-seq
MIRT815570	hsa-miR-548an	CLIP-seq
MIRT740078	hsa-miR-550a	CLIP-seq
MIRT815571	hsa-miR-558	CLIP-seq
MIRT815572	hsa-miR-561	CLIP-seq
MIRT815573	hsa-miR-574-5p	CLIP-seq
MIRT815574	hsa-miR-579	CLIP-seq
MIRT815575	hsa-miR-623	CLIP-seq
MIRT815576	hsa-miR-650	CLIP-seq
MIRT740073	hsa-miR-654-5p	CLIP-seq
MIRT815577	hsa-miR-657	CLIP-seq
MIRT815578	hsa-miR-664	CLIP-seq
MIRT1941249	hsa-miR-103a	CLIP-seq
MIRT1941250	hsa-miR-107	CLIP-seq
MIRT815519	hsa-miR-1297	CLIP-seq
MIRT1941251	hsa-miR-149	CLIP-seq
MIRT1941252	hsa-miR-15a	CLIP-seq
MIRT1941253	hsa-miR-15b	CLIP-seq
MIRT1941254	hsa-miR-16	CLIP-seq
MIRT1941255	hsa-miR-195	CLIP-seq
MIRT1941256	hsa-miR-24	CLIP-seq
MIRT815526	hsa-miR-26a	CLIP-seq
MIRT815527	hsa-miR-26b	CLIP-seq
MIRT1941257	hsa-miR-3064-5p	CLIP-seq
MIRT1941258	hsa-miR-3126-3p	CLIP-seq
MIRT815540	hsa-miR-3714	CLIP-seq
MIRT1941259	hsa-miR-3934	CLIP-seq
MIRT1941260	hsa-miR-3944-5p	CLIP-seq
MIRT1941261	hsa-miR-424	CLIP-seq
MIRT1941262	hsa-miR-4284	CLIP-seq
MIRT815545	hsa-miR-4465	CLIP-seq
MIRT815552	hsa-miR-4532	CLIP-seq
MIRT815563	hsa-miR-4772-3p	CLIP-seq
MIRT1941263	hsa-miR-4794	CLIP-seq
MIRT1941264	hsa-miR-497	CLIP-seq
MIRT1941249	hsa-miR-103a	CLIP-seq
MIRT1941250	hsa-miR-107	CLIP-seq
MIRT2180029	hsa-miR-122	CLIP-seq
MIRT2180030	hsa-miR-125a-3p	CLIP-seq
MIRT815519	hsa-miR-1297	CLIP-seq
MIRT1941251	hsa-miR-149	CLIP-seq
MIRT1941252	hsa-miR-15a	CLIP-seq
MIRT1941253	hsa-miR-15b	CLIP-seq
MIRT1941254	hsa-miR-16	CLIP-seq
MIRT815522	hsa-miR-188-5p	CLIP-seq
MIRT2180031	hsa-miR-1910	CLIP-seq
MIRT1941255	hsa-miR-195	CLIP-seq
MIRT1941256	hsa-miR-24	CLIP-seq
MIRT815526	hsa-miR-26a	CLIP-seq
MIRT815527	hsa-miR-26b	CLIP-seq
MIRT2180032	hsa-miR-298	CLIP-seq
MIRT1941257	hsa-miR-3064-5p	CLIP-seq
MIRT2180033	hsa-miR-3074-3p	CLIP-seq
MIRT1941258	hsa-miR-3126-3p	CLIP-seq
MIRT2180034	hsa-miR-3140-5p	CLIP-seq
MIRT1941259	hsa-miR-3934	CLIP-seq
MIRT1941260	hsa-miR-3944-5p	CLIP-seq
MIRT1941261	hsa-miR-424	CLIP-seq
MIRT1941262	hsa-miR-4284	CLIP-seq
MIRT2180035	hsa-miR-4422	CLIP-seq
MIRT740071	hsa-miR-4447	CLIP-seq
MIRT815545	hsa-miR-4465	CLIP-seq
MIRT740070	hsa-miR-4472	CLIP-seq
MIRT2180036	hsa-miR-4492	CLIP-seq
MIRT2180037	hsa-miR-4498	CLIP-seq
MIRT815552	hsa-miR-4532	CLIP-seq
MIRT2180038	hsa-miR-4676-5p	CLIP-seq
MIRT815560	hsa-miR-4729	CLIP-seq
MIRT2180039	hsa-miR-4766-5p	CLIP-seq
MIRT815563	hsa-miR-4772-3p	CLIP-seq
MIRT1941263	hsa-miR-4794	CLIP-seq
MIRT1941264	hsa-miR-497	CLIP-seq
MIRT2180040	hsa-miR-575	CLIP-seq
MIRT2180041	hsa-miR-762	CLIP-seq
MIRT2180042	hsa-miR-764	CLIP-seq
MIRT2180043	hsa-miR-892b	CLIP-seq
MIRT815519	hsa-miR-1297	CLIP-seq
MIRT815526	hsa-miR-26a	CLIP-seq
MIRT815527	hsa-miR-26b	CLIP-seq
MIRT815545	hsa-miR-4465	CLIP-seq
MIRT815552	hsa-miR-4532	CLIP-seq
MIRT815519	hsa-miR-1297	CLIP-seq
MIRT815526	hsa-miR-26a	CLIP-seq
MIRT815527	hsa-miR-26b	CLIP-seq
MIRT815545	hsa-miR-4465	CLIP-seq
MIRT815552	hsa-miR-4532	CLIP-seq
MIRT815519	hsa-miR-1297	CLIP-seq
MIRT815526	hsa-miR-26a	CLIP-seq
MIRT815527	hsa-miR-26b	CLIP-seq
MIRT815545	hsa-miR-4465	CLIP-seq
MIRT815552	hsa-miR-4532	CLIP-seq
MIRT815519	hsa-miR-1297	CLIP-seq
MIRT815526	hsa-miR-26a	CLIP-seq
MIRT815527	hsa-miR-26b	CLIP-seq
MIRT815545	hsa-miR-4465	CLIP-seq
MIRT815552	hsa-miR-4532	CLIP-seq

Show/Hide all (24)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003779	Function	Actin binding	IEA
GO:0005515	Function	Protein binding	IPI	21098279, 22921828, 25519916, 26496610, 32296183, 33961781, 35271311
GO:0005654	Component	Nucleoplasm	IBA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA	19366662
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0005886	Component	Plasma membrane	IDA
GO:0005912	Component	Adherens junction	HDA	25468996
GO:0007009	Process	Plasma membrane organization	IEA
GO:0015629	Component	Actin cytoskeleton	IDA	19366662
GO:0030833	Process	Regulation of actin filament polymerization	IEA
GO:0030838	Process	Positive regulation of actin filament polymerization	IBA
GO:0030838	Process	Positive regulation of actin filament polymerization	IDA	21098279
GO:0032956	Process	Regulation of actin cytoskeleton organization	IMP	19366662
GO:0051017	Process	Actin filament bundle assembly	IBA
GO:0051764	Process	Actin crosslink formation	IBA
GO:0070062	Component	Extracellular exosome	HDA	19056867, 23533145
GO:0070064	Function	Proline-rich region binding	IDA	21098279
GO:0070064	Function	Proline-rich region binding	IEA
GO:0098609	Process	Cell-cell adhesion	IEA
GO:0098641	Function	Cadherin binding involved in cell-cell adhesion	HDA	25468996

MIM	HGNC	e!Ensembl
611877	21649	ENSG00000006453

Q9UHR4

Protein name

BAR/IMD domain-containing adapter protein 2-like 1 (Brain-specific angiogenesis inhibitor 1-associated protein 2-like protein 1) (BAI1-associated protein 2-like protein 1) (Insulin receptor tyrosine kinase substrate)

Protein function

May function as adapter protein. Involved in the formation of clusters of actin bundles. Plays a role in the reorganization of the actin cytoskeleton in response to bacterial infection. {ECO:0000269|PubMed:17430976, ECO:0000269|PubMed:19366662,

PDB

2KXC , 2LNH

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF08397	IMD	16 → 236	IRSp53/MIM homology domain	Family
PF14604	SH3_9	347 → 398	Variant SH3 domain	Domain

Sequence

MSRGPEEVNRLTESTYRNVMEQFNPGLRNLINLGKNYEKAVNAMILAGKAYYDGVAKIGE
IATGSPVSTELGHVLIEISSTHKKLNESLDENFKKFHKEIIHELEKKIELDVKYMNATLK
RYQTEHKNKLESLEKSQAELKKIRRKSQGSRNALKYEHKEIEYVETVTSRQSEIQKFIAD
GCKEALLEEKRRFCFLVDKHCGFANHIHYYHLQSAELLNSKLPRWQETCVDAIKVPEKIM
NMIEEIKTPASTPVSGTPQASPMIERSNVVRKDYDTLSKCSPKMPPAPSGRAYTSPLIDM
FNNPATAAPNSQRVNNSTGTSEDPSLQRSVSVATGLNMMKKQKVKTIFPHTAGSNKTLLS
FAQGDVITLLIPEEKDGWLYGEHDVSKARGWFPSSYTKLLEENETEAVTVPTPSPTPVRS
ISTVNLSENSSVVIPPPDYLECLSMGAAADRRADSARTTSTFKAPASKPETAAPNDANGT
AKPPFLSGENPFATVKLRPTVTNDRSAPIIR

Sequence length

511

Interactions

View interactions

	KEGG
	Pathogenic Escherichia coli infection

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (10)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ARTHRITIS, RHEUMATOID	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOGONADISM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIGRAINE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (19)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Breast Carcinoma	Breast Carcinoma	GWASCAT_DG	29059683		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	36308067	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	24452392		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	26222696	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	26222696		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	26222696		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	36308067	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	24452392		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	26222696		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	26222696		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	26222696, 26892443		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	26222696		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	26222696	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	34321959	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	CTD_human_DG	17568789		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach neoplasms	Pubtator	34374630	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	36217175	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroiditis	Thyroiditis	Pubtator	36217175	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	36308067	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

BAIAP2L1 (BAR/IMD domain containing adaptor protein 2 like 1)