Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	55968
Gene name	NSFL1 cofactor
Gene symbol	NSFL1C
Synonyms (NCBI Gene)	P47UBX1UBXD10UBXN2CdJ776F14.1
Chromosome	20
Chromosome location	20p13
Summary	N-ethylmaleimide-sensitive factor (NSF) and valosin-containing protein (p97) are two ATPases known to be involved in transport vesicle/target membrane fusion and fusions between membrane compartments. A trimer of the protein encoded by this gene binds a h

130

Show/Hide all (130)

miRTarBase ID	miRNA	Experiments	Reference
MIRT019752	hsa-miR-375	Microarray	20215506
MIRT021624	hsa-miR-142-3p	Microarray	17612493
MIRT049768	hsa-miR-92a-3p	CLASH	23622248
MIRT044711	hsa-miR-320a	CLASH	23622248
MIRT042168	hsa-miR-484	CLASH	23622248
MIRT041619	hsa-miR-146b-5p	CLASH	23622248
MIRT513023	hsa-miR-6887-3p	PAR-CLIP	20371350
MIRT513022	hsa-miR-6795-3p	PAR-CLIP	20371350
MIRT513021	hsa-miR-4667-3p	PAR-CLIP	20371350
MIRT513020	hsa-miR-6734-3p	PAR-CLIP	20371350
MIRT513019	hsa-miR-3667-3p	PAR-CLIP	20371350
MIRT513018	hsa-miR-3925-3p	PAR-CLIP	20371350
MIRT513017	hsa-miR-452-3p	PAR-CLIP	20371350
MIRT513016	hsa-miR-6826-3p	PAR-CLIP	20371350
MIRT513015	hsa-miR-4691-5p	PAR-CLIP	20371350
MIRT513014	hsa-miR-6792-3p	PAR-CLIP	20371350
MIRT513013	hsa-miR-6749-3p	PAR-CLIP	20371350
MIRT513012	hsa-miR-3679-3p	PAR-CLIP	20371350
MIRT529393	hsa-miR-4789-3p	PAR-CLIP	22012620
MIRT529392	hsa-miR-4643	PAR-CLIP	22012620
MIRT513023	hsa-miR-6887-3p	PAR-CLIP	22012620
MIRT513022	hsa-miR-6795-3p	PAR-CLIP	22012620
MIRT513021	hsa-miR-4667-3p	PAR-CLIP	22012620
MIRT513020	hsa-miR-6734-3p	PAR-CLIP	22012620
MIRT513019	hsa-miR-3667-3p	PAR-CLIP	22012620
MIRT513018	hsa-miR-3925-3p	PAR-CLIP	22012620
MIRT529391	hsa-miR-130b-5p	PAR-CLIP	22012620
MIRT529390	hsa-miR-466	PAR-CLIP	22012620
MIRT513017	hsa-miR-452-3p	PAR-CLIP	22012620
MIRT513016	hsa-miR-6826-3p	PAR-CLIP	22012620
MIRT513015	hsa-miR-4691-5p	PAR-CLIP	22012620
MIRT513014	hsa-miR-6792-3p	PAR-CLIP	22012620
MIRT513013	hsa-miR-6749-3p	PAR-CLIP	22012620
MIRT513012	hsa-miR-3679-3p	PAR-CLIP	22012620
MIRT529389	hsa-miR-4650-5p	PAR-CLIP	22012620
MIRT513023	hsa-miR-6887-3p	PAR-CLIP	23446348
MIRT513022	hsa-miR-6795-3p	PAR-CLIP	23446348
MIRT513021	hsa-miR-4667-3p	PAR-CLIP	23446348
MIRT513020	hsa-miR-6734-3p	PAR-CLIP	23446348
MIRT513019	hsa-miR-3667-3p	PAR-CLIP	23446348
MIRT513018	hsa-miR-3925-3p	PAR-CLIP	23446348
MIRT513017	hsa-miR-452-3p	PAR-CLIP	23446348
MIRT513016	hsa-miR-6826-3p	PAR-CLIP	23446348
MIRT513015	hsa-miR-4691-5p	PAR-CLIP	23446348
MIRT513014	hsa-miR-6792-3p	PAR-CLIP	23446348
MIRT513013	hsa-miR-6749-3p	PAR-CLIP	23446348
MIRT513012	hsa-miR-3679-3p	PAR-CLIP	23446348
MIRT513023	hsa-miR-6887-3p	PAR-CLIP	20371350
MIRT513022	hsa-miR-6795-3p	PAR-CLIP	20371350
MIRT513021	hsa-miR-4667-3p	PAR-CLIP	20371350
MIRT513020	hsa-miR-6734-3p	PAR-CLIP	20371350
MIRT513019	hsa-miR-3667-3p	PAR-CLIP	20371350
MIRT513018	hsa-miR-3925-3p	PAR-CLIP	20371350
MIRT513017	hsa-miR-452-3p	PAR-CLIP	20371350
MIRT513016	hsa-miR-6826-3p	PAR-CLIP	20371350
MIRT513015	hsa-miR-4691-5p	PAR-CLIP	20371350
MIRT513014	hsa-miR-6792-3p	PAR-CLIP	20371350
MIRT513013	hsa-miR-6749-3p	PAR-CLIP	20371350
MIRT513012	hsa-miR-3679-3p	PAR-CLIP	20371350
MIRT529393	hsa-miR-4789-3p	PAR-CLIP	22012620
MIRT529392	hsa-miR-4643	PAR-CLIP	22012620
MIRT513023	hsa-miR-6887-3p	PAR-CLIP	22012620
MIRT513022	hsa-miR-6795-3p	PAR-CLIP	22012620
MIRT513021	hsa-miR-4667-3p	PAR-CLIP	22012620
MIRT513020	hsa-miR-6734-3p	PAR-CLIP	22012620
MIRT513019	hsa-miR-3667-3p	PAR-CLIP	22012620
MIRT513018	hsa-miR-3925-3p	PAR-CLIP	22012620
MIRT529391	hsa-miR-130b-5p	PAR-CLIP	22012620
MIRT529390	hsa-miR-466	PAR-CLIP	22012620
MIRT513017	hsa-miR-452-3p	PAR-CLIP	22012620
MIRT513016	hsa-miR-6826-3p	PAR-CLIP	22012620
MIRT513015	hsa-miR-4691-5p	PAR-CLIP	22012620
MIRT513014	hsa-miR-6792-3p	PAR-CLIP	22012620
MIRT513013	hsa-miR-6749-3p	PAR-CLIP	22012620
MIRT513012	hsa-miR-3679-3p	PAR-CLIP	22012620
MIRT529389	hsa-miR-4650-5p	PAR-CLIP	22012620
MIRT513023	hsa-miR-6887-3p	PAR-CLIP	23446348
MIRT513022	hsa-miR-6795-3p	PAR-CLIP	23446348
MIRT513021	hsa-miR-4667-3p	PAR-CLIP	23446348
MIRT513020	hsa-miR-6734-3p	PAR-CLIP	23446348
MIRT513019	hsa-miR-3667-3p	PAR-CLIP	23446348
MIRT513018	hsa-miR-3925-3p	PAR-CLIP	23446348
MIRT513017	hsa-miR-452-3p	PAR-CLIP	23446348
MIRT513016	hsa-miR-6826-3p	PAR-CLIP	23446348
MIRT513015	hsa-miR-4691-5p	PAR-CLIP	23446348
MIRT513014	hsa-miR-6792-3p	PAR-CLIP	23446348
MIRT513013	hsa-miR-6749-3p	PAR-CLIP	23446348
MIRT513012	hsa-miR-3679-3p	PAR-CLIP	23446348
MIRT1195067	hsa-miR-129-5p	CLIP-seq
MIRT1195068	hsa-miR-1976	CLIP-seq
MIRT1195069	hsa-miR-2276	CLIP-seq
MIRT1195070	hsa-miR-323b-5p	CLIP-seq
MIRT1195071	hsa-miR-4709-5p	CLIP-seq
MIRT1195072	hsa-miR-542-3p	CLIP-seq
MIRT1195073	hsa-miR-659	CLIP-seq
MIRT1195074	hsa-miR-1287	CLIP-seq
MIRT1195075	hsa-miR-29a	CLIP-seq
MIRT1195076	hsa-miR-29b	CLIP-seq
MIRT1195077	hsa-miR-29c	CLIP-seq
MIRT1195078	hsa-miR-3122	CLIP-seq
MIRT1195079	hsa-miR-3135b	CLIP-seq
MIRT1195080	hsa-miR-370	CLIP-seq
MIRT1195081	hsa-miR-3913-5p	CLIP-seq
MIRT1195082	hsa-miR-4434	CLIP-seq
MIRT1195083	hsa-miR-450b-3p	CLIP-seq
MIRT1195084	hsa-miR-4516	CLIP-seq
MIRT1195085	hsa-miR-4531	CLIP-seq
MIRT1195086	hsa-miR-4713-3p	CLIP-seq
MIRT1195087	hsa-miR-570	CLIP-seq
MIRT1195088	hsa-miR-638	CLIP-seq
MIRT1195089	hsa-miR-769-3p	CLIP-seq
MIRT2465750	hsa-miR-1245b-5p	CLIP-seq
MIRT2465751	hsa-miR-150	CLIP-seq
MIRT2465752	hsa-miR-3142	CLIP-seq
MIRT2465753	hsa-miR-3183	CLIP-seq
MIRT2465754	hsa-miR-4713-5p	CLIP-seq
MIRT2465755	hsa-miR-4723-3p	CLIP-seq
MIRT2465756	hsa-miR-532-3p	CLIP-seq
MIRT2583057	hsa-miR-1912	CLIP-seq
MIRT2583058	hsa-miR-3130-5p	CLIP-seq
MIRT2583059	hsa-miR-3680	CLIP-seq
MIRT2583060	hsa-miR-4482	CLIP-seq
MIRT2583061	hsa-miR-4530	CLIP-seq
MIRT2583062	hsa-miR-922	CLIP-seq
MIRT2583057	hsa-miR-1912	CLIP-seq
MIRT2583058	hsa-miR-3130-5p	CLIP-seq
MIRT2583059	hsa-miR-3680	CLIP-seq
MIRT2583060	hsa-miR-4482	CLIP-seq
MIRT2583061	hsa-miR-4530	CLIP-seq
MIRT2583062	hsa-miR-922	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
SPI1	Unknown	10542290

Show/Hide all (28)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000045	Process	Autophagosome assembly	IBA
GO:0000132	Process	Establishment of mitotic spindle orientation	IEA
GO:0000132	Process	Establishment of mitotic spindle orientation	IGI	23649807
GO:0005515	Function	Protein binding	IPI	16169070, 16275660, 20414249, 21645854, 21900206, 22466964, 25416956, 26496610, 26712280, 29997244, 32814053, 33961781, 35271311, 37776851
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005694	Component	Chromosome	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	NAS	16601695
GO:0005794	Component	Golgi apparatus	IEA
GO:0005795	Component	Golgi stack	IEA
GO:0005813	Component	Centrosome	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005856	Component	Cytoskeleton	IEA
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	NAS	16601695
GO:0007030	Process	Golgi organization	IBA
GO:0008289	Function	Lipid binding	IEA
GO:0031468	Process	Nuclear membrane reassembly	IBA
GO:0043130	Function	Ubiquitin binding	IBA
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IBA
GO:0046604	Process	Positive regulation of mitotic centrosome separation	IEA
GO:0046604	Process	Positive regulation of mitotic centrosome separation	IGI	23649807
GO:0061025	Process	Membrane fusion	IBA
GO:1904780	Process	Negative regulation of protein localization to centrosome	IEA
GO:1904780	Process	Negative regulation of protein localization to centrosome	IGI	23649807
GO:1990730	Component	VCP-NSFL1C complex	IEA
GO:1990730	Component	VCP-NSFL1C complex	IPI	21645854
GO:1990730	Component	VCP-NSFL1C complex	ISS

MIM	HGNC	e!Ensembl
606610	15912	ENSG00000088833

Q9UNZ2

Protein name

NSFL1 cofactor p47 (UBX domain-containing protein 2C) (p97 cofactor p47)

Protein function

Reduces the ATPase activity of VCP (By similarity). Necessary for the fragmentation of Golgi stacks during mitosis and for VCP-mediated reassembly of Golgi stacks after mitosis (By similarity). May play a role in VCP-mediated formation of transi

PDB

1SS6 , 8HRZ

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF14555	UBA_4	6 → 48		Domain
PF08059	SEP	184 → 258	SEP domain	Domain
PF00789	UBX	290 → 369	UBX domain	Domain

Sequence

MAAERQEALREFVAVTGAEEDRARFFLESAGWDLQIALASFYEDGGDEDIVTISQATPSS
VSRGTAPSDNRVTSFRDLIHDQDEDEEEEEGQRFYAGGSERSGQQIVGPPRKKSPNELVD
DLFKGAKEHGAVAVERVTKSPGETSKPRPFAGGGYRLGAAPEEESAYVAGEKRQHSSQDV
HVVLKLWKSGFSLDNGELRSYQDPSNAQFLESIRRGEVPAELRRLAHGGQVNLDMEDHRD
EDFVKPKGAFKAFTGEGQKLGSTAPQVLSTSSPAQQAENEAKASSSILIDESEPTTNIQI
RLADGGRLVQKFNHSHRISDIRLFIVDARPAMAATSFILMTTFPNKELADESQTLKEANL
LNAVIVQRLT

Sequence length

370

Interactions

View interactions

	KEGG
	Protein processing in endoplasmic reticulum

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
METABOLIC SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SJOGREN SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (15)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	30837480		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	23884469		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	17855441	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic granulomatous disease	Granulomatous Disease	BEFREE	15527168, 2398896		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	15626894		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	28105508		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	19175688	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	28105508		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	30559180		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	15626894		★★★★★ ★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	15626894		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	17918192, 18381585		★★★★★ ★☆☆☆☆ Found in Text Mining only
Motor neuron atrophy	Motor neuron atrophy	BEFREE	29599289		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	LHGDN	19165527		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	15626894		★★★★★ ★☆☆☆☆ Found in Text Mining only

NSFL1C (NSFL1 cofactor)