Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	5596
Gene name	Mitogen-activated protein kinase 4
Gene symbol	MAPK4
Synonyms (NCBI Gene)	ERK-4ERK4PRKM4p63-MAPKp63MAPK
Chromosome	18
Chromosome location	18q21.1-q21.2
Summary	Mitogen-activated protein kinase 4 is a member of the mitogen-activated protein kinase family. Tyrosine kinase growth factor receptors activate mitogen-activated protein kinases which then translocate into the nucleus and phosphorylate nuclear targets. Al

Show/Hide all (49)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016876	hsa-miR-335-5p	Microarray	18185580
MIRT053562	hsa-miR-127-3p	Luciferase reporter assayqRT-PCRWestern blot	23880861
MIRT053562	hsa-miR-127-3p	Luciferase reporter assayqRT-PCRWestern blot	23880861
MIRT1130942	hsa-miR-1206	CLIP-seq
MIRT1130943	hsa-miR-1275	CLIP-seq
MIRT1130944	hsa-miR-132	CLIP-seq
MIRT1130945	hsa-miR-2054	CLIP-seq
MIRT1130946	hsa-miR-212	CLIP-seq
MIRT1130947	hsa-miR-28-5p	CLIP-seq
MIRT1130948	hsa-miR-3123	CLIP-seq
MIRT1130949	hsa-miR-3139	CLIP-seq
MIRT1130950	hsa-miR-3160-3p	CLIP-seq
MIRT1130951	hsa-miR-3607-3p	CLIP-seq
MIRT1130952	hsa-miR-3668	CLIP-seq
MIRT1130953	hsa-miR-3686	CLIP-seq
MIRT1130954	hsa-miR-3925-5p	CLIP-seq
MIRT1130955	hsa-miR-4271	CLIP-seq
MIRT1130956	hsa-miR-4281	CLIP-seq
MIRT1130957	hsa-miR-4464	CLIP-seq
MIRT1130958	hsa-miR-4525	CLIP-seq
MIRT1130959	hsa-miR-4665-5p	CLIP-seq
MIRT1130960	hsa-miR-4723-5p	CLIP-seq
MIRT1130961	hsa-miR-4725-3p	CLIP-seq
MIRT1130962	hsa-miR-4732-5p	CLIP-seq
MIRT1130963	hsa-miR-4748	CLIP-seq
MIRT1130964	hsa-miR-501-3p	CLIP-seq
MIRT1130965	hsa-miR-502-3p	CLIP-seq
MIRT1130966	hsa-miR-625	CLIP-seq
MIRT1130967	hsa-miR-708	CLIP-seq
MIRT1130968	hsa-miR-767-5p	CLIP-seq
MIRT2037355	hsa-miR-223	CLIP-seq
MIRT2037356	hsa-miR-3144-5p	CLIP-seq
MIRT2037357	hsa-miR-3151	CLIP-seq
MIRT2037358	hsa-miR-3191	CLIP-seq
MIRT2037359	hsa-miR-3714	CLIP-seq
MIRT2037360	hsa-miR-4484	CLIP-seq
MIRT2037361	hsa-miR-4652-5p	CLIP-seq
MIRT2037362	hsa-miR-4667-5p	CLIP-seq
MIRT2037363	hsa-miR-4697-3p	CLIP-seq
MIRT2037364	hsa-miR-4700-5p	CLIP-seq
MIRT2037365	hsa-miR-4715-3p	CLIP-seq
MIRT2037366	hsa-miR-4726-3p	CLIP-seq
MIRT2037367	hsa-miR-4771	CLIP-seq
MIRT2037368	hsa-miR-548an	CLIP-seq
MIRT2037357	hsa-miR-3151	CLIP-seq
MIRT2267266	hsa-miR-4447	CLIP-seq
MIRT2267267	hsa-miR-4455	CLIP-seq
MIRT2267268	hsa-miR-4468	CLIP-seq
MIRT2267269	hsa-miR-4472	CLIP-seq

Show/Hide all (28)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000165	Process	MAPK cascade	IEA
GO:0000166	Function	Nucleotide binding	IEA
GO:0004672	Function	Protein kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	IBA
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	TAS
GO:0004707	Function	MAP kinase activity	IEA
GO:0004707	Function	MAP kinase activity	TAS	7969157
GO:0005515	Function	Protein binding	IPI	22939624, 32707033, 36931259
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0005829	Component	Cytosol	TAS
GO:0006468	Process	Protein phosphorylation	TAS	7969157
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0019901	Function	Protein kinase binding	IEA
GO:0019901	Function	Protein kinase binding	ISS
GO:0035556	Process	Intracellular signal transduction	IBA
GO:0042803	Function	Protein homodimerization activity	IEA
GO:0042803	Function	Protein homodimerization activity	ISS
GO:0046982	Function	Protein heterodimerization activity	IEA
GO:0106310	Function	Protein serine kinase activity	IEA

MIM	HGNC	e!Ensembl
176949	6878	ENSG00000141639

P31152

Protein name

Mitogen-activated protein kinase 4 (MAP kinase 4) (MAPK 4) (EC 2.7.11.24) (Extracellular signal-regulated kinase 4) (ERK-4) (MAP kinase isoform p63) (p63-MAPK)

Protein function

Atypical MAPK protein. Phosphorylates microtubule-associated protein 2 (MAP2) and MAPKAPK5. The precise role of the complex formed with MAPKAPK5 is still unclear, but the complex follows a complex set of phosphorylation events: upon interaction

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00069	Pkinase	20 → 312	Protein kinase domain	Domain

Tissue specificity

TISSUE SPECIFICITY: High expression in heart and brain.

Sequence

MAEKGDCIASVYGYDLGGRFVDFQPLGFGVNGLVLSAVDSRACRKVAVKKIALSDARSMK
HALREIKIIRRLDHDNIVKVYEVLGPKGTDLQGELFKFSVAYIVQEYMETDLARLLEQGT
LAEEHAKLFMYQLLRGLKYIHSANVLHRDLKPANIFISTEDLVLKIGDFGLARIVDQHYS
HKGYLSEGLVTKWYRSPRLLLSPNNYTKAIDMWAAGCILAEMLTGRMLFAGAHELEQMQL
ILETIPVIREEDKDELLRVMPSFVSSTWEVKRPLRKLLPEVNSEAIDFLEKILTFNPMDR
LTAEMGLQHPYMSPYSCPEDEPTSQHPFRIEDEIDDIVLMAANQSQLSNWDTCSSRYPVS
LSSDLEWRPDRCQDASEVQRDPRAGSAPLAEDVQVDPRKDSHSSSERFLEQSHSSMERAF
EADYGRSCDYKVGSPSYLDKLLWRDNKPHHYSEPKLILDLSHWKQAAGAPPTATGLADTG
AREDEPASLFLEIAQWVKSTQGGPEHASPPADDPERRLSASPPGRPAPVDGGASPQFDLD
VFISRALKLCTKPEDLPDNKLGDLNGACIPEHPGDLVQTEAFSKERW

Sequence length

587

Interactions

View interactions

	KEGG		Reactome
	IL-17 signaling pathway		MAPK6/MAPK4 signaling

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ASTHMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (20)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	30688659		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	32510852	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	36469137	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	33155194	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	37575065	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Developmental disability	Pubtator	36469137	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	31570734, 36999945	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	36999945	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	28592245	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	30688659		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	23933187, 30688659		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nonorganic psychosis	Nonorganic Psychosis	BEFREE	25504777		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	33155194	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	BEFREE	25504777		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	25504777		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	28319306	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of tongue	Tongue carcinoma	BEFREE	28319306		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	23880861	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	30688659		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	34080025	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

MAPK4 (mitogen-activated protein kinase 4)