Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	5593
Gene name	Protein kinase cGMP-dependent 2
Gene symbol	PRKG2
Synonyms (NCBI Gene)	AMD4PKG2PRKGR2SMDPcGK2cGKII
Chromosome	4
Chromosome location	4q21.21
Summary	This gene encodes a protein that belongs to the serine/threonine protein kinase family of proteins. The encoded protein binds to and inhibits the activation of several receptor tyrosine kinases. The membrane-bound protein is a regulator of intestinal secr

122

Show/Hide all (122)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018075	hsa-miR-335-5p	Microarray	18185580
MIRT023857	hsa-miR-1-3p	Microarray	18668037
MIRT618399	hsa-miR-548a-5p	HITS-CLIP	23824327
MIRT618398	hsa-miR-548ab	HITS-CLIP	23824327
MIRT618397	hsa-miR-548ad-5p	HITS-CLIP	23824327
MIRT618396	hsa-miR-548ae-5p	HITS-CLIP	23824327
MIRT618395	hsa-miR-548ak	HITS-CLIP	23824327
MIRT618394	hsa-miR-548am-5p	HITS-CLIP	23824327
MIRT618393	hsa-miR-548ap-5p	HITS-CLIP	23824327
MIRT618392	hsa-miR-548aq-5p	HITS-CLIP	23824327
MIRT618391	hsa-miR-548ar-5p	HITS-CLIP	23824327
MIRT618390	hsa-miR-548as-5p	HITS-CLIP	23824327
MIRT618389	hsa-miR-548au-5p	HITS-CLIP	23824327
MIRT618388	hsa-miR-548ay-5p	HITS-CLIP	23824327
MIRT618387	hsa-miR-548b-5p	HITS-CLIP	23824327
MIRT618386	hsa-miR-548bb-5p	HITS-CLIP	23824327
MIRT618385	hsa-miR-548c-5p	HITS-CLIP	23824327
MIRT618384	hsa-miR-548d-5p	HITS-CLIP	23824327
MIRT618383	hsa-miR-548h-5p	HITS-CLIP	23824327
MIRT618382	hsa-miR-548i	HITS-CLIP	23824327
MIRT618381	hsa-miR-548j-5p	HITS-CLIP	23824327
MIRT618380	hsa-miR-548o-5p	HITS-CLIP	23824327
MIRT618379	hsa-miR-548w	HITS-CLIP	23824327
MIRT618378	hsa-miR-548y	HITS-CLIP	23824327
MIRT618377	hsa-miR-559	HITS-CLIP	23824327
MIRT618376	hsa-miR-548av-5p	HITS-CLIP	23824327
MIRT618375	hsa-miR-548k	HITS-CLIP	23824327
MIRT618374	hsa-miR-8054	HITS-CLIP	23824327
MIRT618373	hsa-miR-548l	HITS-CLIP	23824327
MIRT618372	hsa-miR-452-3p	HITS-CLIP	23824327
MIRT618371	hsa-miR-6875-3p	HITS-CLIP	23824327
MIRT618370	hsa-miR-4659a-3p	HITS-CLIP	23824327
MIRT618369	hsa-miR-4659b-3p	HITS-CLIP	23824327
MIRT618399	hsa-miR-548a-5p	HITS-CLIP	23824327
MIRT618398	hsa-miR-548ab	HITS-CLIP	23824327
MIRT618397	hsa-miR-548ad-5p	HITS-CLIP	23824327
MIRT618396	hsa-miR-548ae-5p	HITS-CLIP	23824327
MIRT618395	hsa-miR-548ak	HITS-CLIP	23824327
MIRT618394	hsa-miR-548am-5p	HITS-CLIP	23824327
MIRT618393	hsa-miR-548ap-5p	HITS-CLIP	23824327
MIRT618392	hsa-miR-548aq-5p	HITS-CLIP	23824327
MIRT618391	hsa-miR-548ar-5p	HITS-CLIP	23824327
MIRT618390	hsa-miR-548as-5p	HITS-CLIP	23824327
MIRT618389	hsa-miR-548au-5p	HITS-CLIP	23824327
MIRT618388	hsa-miR-548ay-5p	HITS-CLIP	23824327
MIRT618387	hsa-miR-548b-5p	HITS-CLIP	23824327
MIRT618386	hsa-miR-548bb-5p	HITS-CLIP	23824327
MIRT618385	hsa-miR-548c-5p	HITS-CLIP	23824327
MIRT618384	hsa-miR-548d-5p	HITS-CLIP	23824327
MIRT618383	hsa-miR-548h-5p	HITS-CLIP	23824327
MIRT618382	hsa-miR-548i	HITS-CLIP	23824327
MIRT618381	hsa-miR-548j-5p	HITS-CLIP	23824327
MIRT618380	hsa-miR-548o-5p	HITS-CLIP	23824327
MIRT618379	hsa-miR-548w	HITS-CLIP	23824327
MIRT618378	hsa-miR-548y	HITS-CLIP	23824327
MIRT618377	hsa-miR-559	HITS-CLIP	23824327
MIRT618376	hsa-miR-548av-5p	HITS-CLIP	23824327
MIRT618375	hsa-miR-548k	HITS-CLIP	23824327
MIRT618374	hsa-miR-8054	HITS-CLIP	23824327
MIRT618373	hsa-miR-548l	HITS-CLIP	23824327
MIRT618372	hsa-miR-452-3p	HITS-CLIP	23824327
MIRT618371	hsa-miR-6875-3p	HITS-CLIP	23824327
MIRT618370	hsa-miR-4659a-3p	HITS-CLIP	23824327
MIRT618369	hsa-miR-4659b-3p	HITS-CLIP	23824327
MIRT1263666	hsa-miR-1267	CLIP-seq
MIRT1263667	hsa-miR-185	CLIP-seq
MIRT1263668	hsa-miR-298	CLIP-seq
MIRT1263669	hsa-miR-3678-3p	CLIP-seq
MIRT1263670	hsa-miR-4306	CLIP-seq
MIRT1263671	hsa-miR-4428	CLIP-seq
MIRT1263672	hsa-miR-4644	CLIP-seq
MIRT1263673	hsa-miR-4652-3p	CLIP-seq
MIRT1263674	hsa-miR-548a-3p	CLIP-seq
MIRT1263675	hsa-miR-548ae	CLIP-seq
MIRT1263676	hsa-miR-548aj	CLIP-seq
MIRT1263677	hsa-miR-548am	CLIP-seq
MIRT1263678	hsa-miR-548e	CLIP-seq
MIRT1263679	hsa-miR-548f	CLIP-seq
MIRT1263680	hsa-miR-548x	CLIP-seq
MIRT1263681	hsa-miR-578	CLIP-seq
MIRT2077600	hsa-miR-4496	CLIP-seq
MIRT2077601	hsa-miR-651	CLIP-seq
MIRT2304149	hsa-miR-3647-3p	CLIP-seq
MIRT2304150	hsa-miR-4729	CLIP-seq
MIRT2601115	hsa-miR-1251	CLIP-seq
MIRT2601116	hsa-miR-219-5p	CLIP-seq
MIRT2601117	hsa-miR-3190	CLIP-seq
MIRT2601118	hsa-miR-3920	CLIP-seq
MIRT2601119	hsa-miR-3978	CLIP-seq
MIRT2601120	hsa-miR-4252	CLIP-seq
MIRT2601121	hsa-miR-4274	CLIP-seq
MIRT2601122	hsa-miR-4445	CLIP-seq
MIRT2601123	hsa-miR-4519	CLIP-seq
MIRT2601124	hsa-miR-4752	CLIP-seq
MIRT2601125	hsa-miR-4782-3p	CLIP-seq
MIRT2601126	hsa-miR-495	CLIP-seq
MIRT2601127	hsa-miR-508-3p	CLIP-seq
MIRT2601128	hsa-miR-539	CLIP-seq
MIRT2601129	hsa-miR-580	CLIP-seq
MIRT2601130	hsa-miR-760	CLIP-seq
MIRT2601115	hsa-miR-1251	CLIP-seq
MIRT2688647	hsa-miR-2054	CLIP-seq
MIRT2601116	hsa-miR-219-5p	CLIP-seq
MIRT2601117	hsa-miR-3190	CLIP-seq
MIRT2688648	hsa-miR-374c	CLIP-seq
MIRT2688649	hsa-miR-380	CLIP-seq
MIRT2601118	hsa-miR-3920	CLIP-seq
MIRT2601119	hsa-miR-3978	CLIP-seq
MIRT2601120	hsa-miR-4252	CLIP-seq
MIRT2601121	hsa-miR-4274	CLIP-seq
MIRT2601122	hsa-miR-4445	CLIP-seq
MIRT2601123	hsa-miR-4519	CLIP-seq
MIRT2601124	hsa-miR-4752	CLIP-seq
MIRT2601125	hsa-miR-4782-3p	CLIP-seq
MIRT2601126	hsa-miR-495	CLIP-seq
MIRT2688650	hsa-miR-499-3p	CLIP-seq
MIRT2688651	hsa-miR-499a-3p	CLIP-seq
MIRT2601127	hsa-miR-508-3p	CLIP-seq
MIRT2601128	hsa-miR-539	CLIP-seq
MIRT2601129	hsa-miR-580	CLIP-seq
MIRT2688652	hsa-miR-655	CLIP-seq
MIRT2601130	hsa-miR-760	CLIP-seq

Show/Hide all (30)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0004672	Function	Protein kinase activity	IEA
GO:0004672	Function	Protein kinase activity	TAS	8607838
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004692	Function	CGMP-dependent protein kinase activity	IEA
GO:0004692	Function	CGMP-dependent protein kinase activity	IMP	33106379
GO:0004692	Function	CGMP-dependent protein kinase activity	TAS
GO:0005524	Function	ATP binding	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IEA
GO:0006468	Process	Protein phosphorylation	IMP	15905169, 33106379
GO:0006468	Process	Protein phosphorylation	TAS	8607838
GO:0007165	Process	Signal transduction	IBA
GO:0007165	Process	Signal transduction	IMP	33106379
GO:0007165	Process	Signal transduction	TAS	8607838
GO:0016020	Component	Membrane	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016324	Component	Apical plasma membrane	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0030553	Function	CGMP binding	IEA
GO:0031965	Component	Nuclear membrane	IEA
GO:0032332	Process	Positive regulation of chondrocyte differentiation	IEA
GO:0042802	Function	Identical protein binding	IEA
GO:0046146	Process	Tetrahydrobiopterin metabolic process	TAS
GO:0051019	Function	Mitogen-activated protein kinase binding	IMP	33106379
GO:0072659	Process	Protein localization to plasma membrane	IEA
GO:0106310	Function	Protein serine kinase activity	IEA
GO:0106310	Function	Protein serine kinase activity	IMP	33106379
GO:1903829	Process	Positive regulation of protein localization	IEA
GO:2001226	Process	Negative regulation of chloride transport	IEA

MIM	HGNC	e!Ensembl
601591	9416	ENSG00000138669

Q13237

Protein name

cGMP-dependent protein kinase 2 (cGK 2) (cGK2) (EC 2.7.11.12) (cGMP-dependent protein kinase II) (cGKII)

Protein function

Crucial regulator of intestinal secretion and bone growth. Phosphorylates and activates CFTR on the plasma membrane. Plays a key role in intestinal secretion by regulating cGMP-dependent translocation of CFTR in jejunum (PubMed:33106379). Acts d

PDB

5BV6 , 5C6C , 5C8W , 5JIX , 5JIZ , 6BQ8

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00027	cNMP_binding	186 → 269	Cyclic nucleotide-binding domain	Domain
PF00027	cNMP_binding	304 → 393	Cyclic nucleotide-binding domain	Domain
PF00069	Pkinase	453 → 711	Protein kinase domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Highly concentrated in brain, lung and intestinal mucosa.

Sequence

MGNGSVKPKHSKHPDGHSGNLTTDALRNKVTELERELRRKDAEIQEREYHLKELREQLSK
QTVAIAELTEELQNKCIQLNKLQDVVHMQGGSPLQASPDKVPLEVHRKTSGLVSLHSRRG
AKAGVSAEPTTRTYDLNKPPEFSFEKARVRKDSSEKKLITDALNKNQFLKRLDPQQIKDM
VECMYGRNYQQGSYIIKQGEPGNHIFVLAEGRLEVFQGEKLLSSIPMWTTFGELAILYNC
TRTASVKAITNVKTWALDREVFQNIMRRTAQARDEQYRNFLRSVSLLKNLPEDKLTKIID
CLEVEYYDKGDYIIREGEEGSTFFILAKGKVKVTQSTEGHDQPQLIKTLQKGEYFGEKAL
ISDDVRSANIIAEENDVACLVIDRETFNQTVGTFEELQKYLEGYVANLNRDDEKRHAKRS
MSNWKLSKALSLEMIQLKEKVARFSSSSPFQNLEIIATLGVGGFGRVELVKVKNENVAFA
MKCIRKKHIVDTKQQEHVYSEKRILEELCSPFIVKLYRTFKDNKYVYMLLEACLGGELWS
ILRDRGSFDEPTSKFCVACVTEAFDYLHRLGIIYRDLKPENLILDAEGYLKLVDFGFAKK
IGSGQKTWTFCGTPEYVAPEVILNKGHDFSVDFWSLGILVYELLTGNPPFSGVDQMMTYN
LILKGIEKMDFPRKITRRPEDLIRRLCRQNPTERLGNLKNGINDIKKHRWLNGFNWEGLK
ARSLPSPLQRELKGPIDHSYFDKYPPEKGMPPDELSGWDKDF

Sequence length

762

Interactions

View interactions

	KEGG		Reactome
	cGMP-PKG signaling pathway Hormone signaling Gap junction Platelet activation Circadian entrainment Thermogenesis Long-term depression Olfactory transduction Regulation of lipolysis in adipocytes Renin secretion Salivary secretion		Tetrahydrobiopterin (BH4) synthesis, recycling, salvage and regulation cGMP effects

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (2)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Acromesomelic dysplasia 4	Pathogenic; Likely pathogenic	rs1291510415, rs2110087773, rs2546101657, rs995285513	RCV001786318 RCV001786319 RCV003228231 RCV003228694	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Spondylometaphyseal dysplasia, pagnamenta type	Pathogenic	rs2109933573	RCV001786320	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (13)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ATRIAL FIBRILLATION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal cancer	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DESBUQUOIS SYNDROME	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, HIP	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, KNEE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRKG2-related disorder	Likely benign; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SPONDYLOMETAPHYSEAL DYSPLASIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (24)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acromesomelic dysplasia	Acromesomelic dysplasia	Pubtator	33887582	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of large intestine	Colorectal Cancer	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	19543319		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	19543319	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	22556146, 29028532		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	23233742	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	29587280		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy, Temporal Lobe	Epilepsy	BEFREE	29587280		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	19543319		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	19543319	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gout	Gout	BEFREE	18678579		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gout	Gout	Pubtator	32124961	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperuricemia	Hyperuricemia	BEFREE	18678579		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	27604828		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Mast-Cell	Leukemia	BEFREE	28412213		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	22556146, 29028532		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mastocytosis Systemic	Systemic mastocytosis	Pubtator	33663081	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mastocytosis, Systemic	Mastocytosis	BEFREE	18166785		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloproliferative disease	Myeloproliferative disorder	BEFREE	18262053		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloproliferative disease	Myeloproliferative disorder	LHGDN	18262053		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	19543319		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	29914933		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	29617357		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	29617357	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

PRKG2 (protein kinase cGMP-dependent 2)