Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	55915
Gene name	LanC like glutathione S-transferase 2
Gene symbol	LANCL2
Synonyms (NCBI Gene)	GPR69BTASP
Chromosome	7
Chromosome location	7p11.2

Show/Hide all (92)

miRTarBase ID	miRNA	Experiments	Reference
MIRT440341	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT440341	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT1103940	hsa-miR-3150a-3p	CLIP-seq
MIRT1103941	hsa-miR-3175	CLIP-seq
MIRT1103942	hsa-miR-3194-3p	CLIP-seq
MIRT1103943	hsa-miR-4474-3p	CLIP-seq
MIRT1103944	hsa-miR-4487	CLIP-seq
MIRT1103945	hsa-miR-4667-5p	CLIP-seq
MIRT1103946	hsa-miR-4693-5p	CLIP-seq
MIRT1103947	hsa-miR-4700-5p	CLIP-seq
MIRT1103948	hsa-miR-4717-3p	CLIP-seq
MIRT1103949	hsa-miR-4717-5p	CLIP-seq
MIRT1103950	hsa-miR-604	CLIP-seq
MIRT1103951	hsa-miR-647	CLIP-seq
MIRT1103952	hsa-miR-939	CLIP-seq
MIRT1103944	hsa-miR-4487	CLIP-seq
MIRT1103946	hsa-miR-4693-5p	CLIP-seq
MIRT1103948	hsa-miR-4717-3p	CLIP-seq
MIRT1103944	hsa-miR-4487	CLIP-seq
MIRT1103946	hsa-miR-4693-5p	CLIP-seq
MIRT1103948	hsa-miR-4717-3p	CLIP-seq
MIRT2028397	hsa-miR-1207-5p	CLIP-seq
MIRT2028398	hsa-miR-155	CLIP-seq
MIRT2028399	hsa-miR-1827	CLIP-seq
MIRT2028400	hsa-miR-1909	CLIP-seq
MIRT2028401	hsa-miR-204	CLIP-seq
MIRT2028402	hsa-miR-211	CLIP-seq
MIRT1103940	hsa-miR-3150a-3p	CLIP-seq
MIRT2028403	hsa-miR-3153	CLIP-seq
MIRT1103941	hsa-miR-3175	CLIP-seq
MIRT2028404	hsa-miR-3911	CLIP-seq
MIRT1103948	hsa-miR-4717-3p	CLIP-seq
MIRT2028405	hsa-miR-4763-3p	CLIP-seq
MIRT2028406	hsa-miR-569	CLIP-seq
MIRT1103952	hsa-miR-939	CLIP-seq
MIRT2028407	hsa-miR-940	CLIP-seq
MIRT2028397	hsa-miR-1207-5p	CLIP-seq
MIRT2259506	hsa-miR-133a	CLIP-seq
MIRT2259507	hsa-miR-133b	CLIP-seq
MIRT2028398	hsa-miR-155	CLIP-seq
MIRT2028399	hsa-miR-1827	CLIP-seq
MIRT2028400	hsa-miR-1909	CLIP-seq
MIRT2259508	hsa-miR-2861	CLIP-seq
MIRT2259509	hsa-miR-298	CLIP-seq
MIRT2259510	hsa-miR-3065-3p	CLIP-seq
MIRT2259511	hsa-miR-3119	CLIP-seq
MIRT2259512	hsa-miR-3140-3p	CLIP-seq
MIRT2259513	hsa-miR-3184	CLIP-seq
MIRT2259514	hsa-miR-330-3p	CLIP-seq
MIRT2259515	hsa-miR-3913-3p	CLIP-seq
MIRT2259516	hsa-miR-423-5p	CLIP-seq
MIRT2259517	hsa-miR-4299	CLIP-seq
MIRT2259518	hsa-miR-4456	CLIP-seq
MIRT1103944	hsa-miR-4487	CLIP-seq
MIRT2259519	hsa-miR-4502	CLIP-seq
MIRT2259520	hsa-miR-4506	CLIP-seq
MIRT1103946	hsa-miR-4693-5p	CLIP-seq
MIRT1103948	hsa-miR-4717-3p	CLIP-seq
MIRT2028405	hsa-miR-4763-3p	CLIP-seq
MIRT2259521	hsa-miR-489	CLIP-seq
MIRT2259522	hsa-miR-548q	CLIP-seq
MIRT2028406	hsa-miR-569	CLIP-seq
MIRT2028407	hsa-miR-940	CLIP-seq
MIRT1103944	hsa-miR-4487	CLIP-seq
MIRT1103946	hsa-miR-4693-5p	CLIP-seq
MIRT1103948	hsa-miR-4717-3p	CLIP-seq
MIRT2028397	hsa-miR-1207-5p	CLIP-seq
MIRT2028398	hsa-miR-155	CLIP-seq
MIRT2028399	hsa-miR-1827	CLIP-seq
MIRT2028400	hsa-miR-1909	CLIP-seq
MIRT2259509	hsa-miR-298	CLIP-seq
MIRT1103948	hsa-miR-4717-3p	CLIP-seq
MIRT2028405	hsa-miR-4763-3p	CLIP-seq
MIRT2028406	hsa-miR-569	CLIP-seq
MIRT2028407	hsa-miR-940	CLIP-seq
MIRT2028397	hsa-miR-1207-5p	CLIP-seq
MIRT2683765	hsa-miR-1261	CLIP-seq
MIRT2028398	hsa-miR-155	CLIP-seq
MIRT2028399	hsa-miR-1827	CLIP-seq
MIRT2028400	hsa-miR-1909	CLIP-seq
MIRT2259509	hsa-miR-298	CLIP-seq
MIRT2259510	hsa-miR-3065-3p	CLIP-seq
MIRT2683766	hsa-miR-3681	CLIP-seq
MIRT2259515	hsa-miR-3913-3p	CLIP-seq
MIRT2683767	hsa-miR-4476	CLIP-seq
MIRT2259519	hsa-miR-4502	CLIP-seq
MIRT1103948	hsa-miR-4717-3p	CLIP-seq
MIRT2028405	hsa-miR-4763-3p	CLIP-seq
MIRT2259521	hsa-miR-489	CLIP-seq
MIRT2683768	hsa-miR-562	CLIP-seq
MIRT2028406	hsa-miR-569	CLIP-seq
MIRT2028407	hsa-miR-940	CLIP-seq

Show/Hide all (21)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	21044950, 25416956, 32296183
GO:0005524	Function	ATP binding	NAS	11762191
GO:0005525	Function	GTP binding	NAS	11762191
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005634	Component	Nucleus	IDA	12566319
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA	12566319
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	12566319, 16979580
GO:0005886	Component	Plasma membrane	IEA
GO:0005975	Process	Carbohydrate metabolic process	IEA
GO:0009789	Process	Positive regulation of abscisic acid-activated signaling pathway	IDA	19667068
GO:0010314	Function	Phosphatidylinositol-5-phosphate binding	IDA	16979580
GO:0016020	Component	Membrane	IEA
GO:0030864	Component	Cortical actin cytoskeleton	IDA	16979580
GO:0031179	Process	Peptide modification	IEA
GO:0032266	Function	Phosphatidylinositol-3-phosphate binding	IDA	16979580
GO:0045892	Process	Negative regulation of DNA-templated transcription	IDA	12566319
GO:0070273	Function	Phosphatidylinositol-4-phosphate binding	IDA	16979580

MIM	HGNC	e!Ensembl
612919	6509	ENSG00000132434

Q9NS86

Protein name

LanC-like protein 2 (Testis-specific adriamycin sensitivity protein)

Protein function

Necessary for abscisic acid (ABA) binding on the cell membrane and activation of the ABA signaling pathway in granulocytes.

PDB

6WQ1

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF05147	LANC_like	96 → 444	Lanthionine synthetase C-like protein	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in brain and testis. {ECO:0000269|PubMed:11762191}.

Sequence

MGETMSKRLKLHLGGEAEMEERAFVNPFPDYEAAAGALLASGAAEETGCVRPPATTDEPG
LPFHQDGKIIHNFIRRIQTKIKDLLQQMEEGLKTADPHDCSAYTGWTGIALLYLQLYRVT
CDQTYLLRSLDYVKRTLRNLNGRRVTFLCGDAGPLAVGAVIYHKLRSDCESQECVTKLLQ
LQRSVVCQESDLPDELLYGRAGYLYALLYLNTEIGPGTVCESAIKEVVNAIIESGKTLSR
EERKTERCPLLYQWHRKQYVGAAHGMAGIYYMLMQPAAKVDQETLTEMVKPSIDYVRHKK
FRSGNYPSSLSNETDRLVHWCHGAPGVIHMLMQAYKVFKEEKYLKEAMECSDVIWQRGLL
RKGYGICHGTAGNGYSFLSLYRLTQDKKYLYRACKFAEWCLDYGAHGCRIPDRPYSLFEG
MAGAIHFLSDVLGPETSRFPAFELDSSKRD

Sequence length

450

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
COLOR VISION DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (10)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Crohn Disease	Crohn Disease	BEFREE	31077582		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	29421190		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	12566319		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	26863628, 34461927	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	24628287, 28764868, 29718324		★★★★★ ★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	29718324		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	29421190		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	12566319		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	LHGDN	19165527		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	31077582		★★★★★ ★☆☆☆☆ Found in Text Mining only

LANCL2 (LanC like glutathione S-transferase 2)