Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	55909
Gene name	Bridging integrator 3
Gene symbol	BIN3
Synonyms (NCBI Gene)	-
Chromosome	8
Chromosome location	8p21.3
Summary	The product of this gene is a member of the BAR domain protein family. The encoded protein is comprised solely of a BAR domain which is predicted to form coiled-coil structures and proposed to mediate dimerization, sense and induce membrane curvature, and

139

Show/Hide all (139)

miRTarBase ID	miRNA	Experiments	Reference
MIRT026045	hsa-miR-196a-5p	Sequencing	20371350
MIRT027575	hsa-miR-98-5p	Microarray	19088304
MIRT032138	hsa-let-7d-5p	Sequencing	20371350
MIRT045640	hsa-miR-149-5p	CLASH	23622248
MIRT821509	hsa-let-7a	CLIP-seq
MIRT821510	hsa-let-7b	CLIP-seq
MIRT821511	hsa-let-7c	CLIP-seq
MIRT821512	hsa-let-7d	CLIP-seq
MIRT821513	hsa-let-7e	CLIP-seq
MIRT821514	hsa-let-7f	CLIP-seq
MIRT821515	hsa-let-7g	CLIP-seq
MIRT821516	hsa-let-7i	CLIP-seq
MIRT821517	hsa-miR-193a-5p	CLIP-seq
MIRT821518	hsa-miR-3618	CLIP-seq
MIRT821519	hsa-miR-3689d	CLIP-seq
MIRT821520	hsa-miR-370	CLIP-seq
MIRT821521	hsa-miR-3927	CLIP-seq
MIRT821522	hsa-miR-4317	CLIP-seq
MIRT821523	hsa-miR-4323	CLIP-seq
MIRT821524	hsa-miR-4443	CLIP-seq
MIRT821525	hsa-miR-4458	CLIP-seq
MIRT821526	hsa-miR-4500	CLIP-seq
MIRT821527	hsa-miR-4731-5p	CLIP-seq
MIRT821528	hsa-miR-515-5p	CLIP-seq
MIRT821529	hsa-miR-518a-5p	CLIP-seq
MIRT821530	hsa-miR-527	CLIP-seq
MIRT821531	hsa-miR-664	CLIP-seq
MIRT821532	hsa-miR-934	CLIP-seq
MIRT821533	hsa-miR-98	CLIP-seq
MIRT1942854	hsa-miR-1302	CLIP-seq
MIRT1942855	hsa-miR-2277-3p	CLIP-seq
MIRT1942856	hsa-miR-3657	CLIP-seq
MIRT1942857	hsa-miR-3660	CLIP-seq
MIRT821520	hsa-miR-370	CLIP-seq
MIRT1942858	hsa-miR-3909	CLIP-seq
MIRT1942859	hsa-miR-4298	CLIP-seq
MIRT1942860	hsa-miR-4436b-5p	CLIP-seq
MIRT1942861	hsa-miR-4526	CLIP-seq
MIRT1942862	hsa-miR-4648	CLIP-seq
MIRT1942863	hsa-miR-4669	CLIP-seq
MIRT1942864	hsa-miR-4691-5p	CLIP-seq
MIRT1942865	hsa-miR-4693-3p	CLIP-seq
MIRT1942866	hsa-miR-574-5p	CLIP-seq
MIRT821509	hsa-let-7a	CLIP-seq
MIRT821510	hsa-let-7b	CLIP-seq
MIRT821511	hsa-let-7c	CLIP-seq
MIRT821512	hsa-let-7d	CLIP-seq
MIRT821513	hsa-let-7e	CLIP-seq
MIRT821514	hsa-let-7f	CLIP-seq
MIRT821515	hsa-let-7g	CLIP-seq
MIRT821516	hsa-let-7i	CLIP-seq
MIRT2181610	hsa-miR-1587	CLIP-seq
MIRT2181611	hsa-miR-1910	CLIP-seq
MIRT821517	hsa-miR-193a-5p	CLIP-seq
MIRT1942855	hsa-miR-2277-3p	CLIP-seq
MIRT2181612	hsa-miR-331-3p	CLIP-seq
MIRT2181613	hsa-miR-3622b-5p	CLIP-seq
MIRT1942856	hsa-miR-3657	CLIP-seq
MIRT2181614	hsa-miR-3685	CLIP-seq
MIRT821519	hsa-miR-3689d	CLIP-seq
MIRT2181615	hsa-miR-378g	CLIP-seq
MIRT1942858	hsa-miR-3909	CLIP-seq
MIRT2181616	hsa-miR-3912	CLIP-seq
MIRT821521	hsa-miR-3927	CLIP-seq
MIRT821524	hsa-miR-4443	CLIP-seq
MIRT821525	hsa-miR-4458	CLIP-seq
MIRT2181617	hsa-miR-4492	CLIP-seq
MIRT2181618	hsa-miR-4498	CLIP-seq
MIRT821526	hsa-miR-4500	CLIP-seq
MIRT2181619	hsa-miR-4656	CLIP-seq
MIRT1942863	hsa-miR-4669	CLIP-seq
MIRT2181620	hsa-miR-4675	CLIP-seq
MIRT1942864	hsa-miR-4691-5p	CLIP-seq
MIRT1942865	hsa-miR-4693-3p	CLIP-seq
MIRT2181621	hsa-miR-4720-5p	CLIP-seq
MIRT821527	hsa-miR-4731-5p	CLIP-seq
MIRT2181622	hsa-miR-4740-3p	CLIP-seq
MIRT2181623	hsa-miR-4741	CLIP-seq
MIRT2181624	hsa-miR-4799-3p	CLIP-seq
MIRT1942866	hsa-miR-574-5p	CLIP-seq
MIRT2181625	hsa-miR-762	CLIP-seq
MIRT821533	hsa-miR-98	CLIP-seq
MIRT2384785	hsa-miR-3672	CLIP-seq
MIRT821520	hsa-miR-370	CLIP-seq
MIRT2384786	hsa-miR-4786-5p	CLIP-seq
MIRT2384787	hsa-miR-769-5p	CLIP-seq
MIRT2181611	hsa-miR-1910	CLIP-seq
MIRT1942855	hsa-miR-2277-3p	CLIP-seq
MIRT2485154	hsa-miR-2861	CLIP-seq
MIRT2485155	hsa-miR-3064-5p	CLIP-seq
MIRT2485156	hsa-miR-3135b	CLIP-seq
MIRT2485157	hsa-miR-320e	CLIP-seq
MIRT2485158	hsa-miR-3616-3p	CLIP-seq
MIRT2485159	hsa-miR-3652	CLIP-seq
MIRT2485160	hsa-miR-4267	CLIP-seq
MIRT2485161	hsa-miR-4276	CLIP-seq
MIRT2485162	hsa-miR-431	CLIP-seq
MIRT2485163	hsa-miR-4430	CLIP-seq
MIRT2485164	hsa-miR-4446-3p	CLIP-seq
MIRT2485165	hsa-miR-4457	CLIP-seq
MIRT2181617	hsa-miR-4492	CLIP-seq
MIRT2181618	hsa-miR-4498	CLIP-seq
MIRT2485166	hsa-miR-4512	CLIP-seq
MIRT2485167	hsa-miR-4646-5p	CLIP-seq
MIRT2485168	hsa-miR-4685-5p	CLIP-seq
MIRT2485169	hsa-miR-4721	CLIP-seq
MIRT2485170	hsa-miR-4722-3p	CLIP-seq
MIRT821527	hsa-miR-4731-5p	CLIP-seq
MIRT2181622	hsa-miR-4740-3p	CLIP-seq
MIRT2485171	hsa-miR-4747-5p	CLIP-seq
MIRT2485172	hsa-miR-4751	CLIP-seq
MIRT2485173	hsa-miR-4755-3p	CLIP-seq
MIRT2485174	hsa-miR-4763-5p	CLIP-seq
MIRT2485175	hsa-miR-511	CLIP-seq
MIRT2181625	hsa-miR-762	CLIP-seq
MIRT2485176	hsa-miR-765	CLIP-seq
MIRT2485177	hsa-miR-938	CLIP-seq
MIRT2181611	hsa-miR-1910	CLIP-seq
MIRT1942855	hsa-miR-2277-3p	CLIP-seq
MIRT2485154	hsa-miR-2861	CLIP-seq
MIRT2485155	hsa-miR-3064-5p	CLIP-seq
MIRT2485157	hsa-miR-320e	CLIP-seq
MIRT2485158	hsa-miR-3616-3p	CLIP-seq
MIRT2485161	hsa-miR-4276	CLIP-seq
MIRT2485162	hsa-miR-431	CLIP-seq
MIRT2485164	hsa-miR-4446-3p	CLIP-seq
MIRT2485165	hsa-miR-4457	CLIP-seq
MIRT2485166	hsa-miR-4512	CLIP-seq
MIRT2485167	hsa-miR-4646-5p	CLIP-seq
MIRT2485168	hsa-miR-4685-5p	CLIP-seq
MIRT2485169	hsa-miR-4721	CLIP-seq
MIRT2485170	hsa-miR-4722-3p	CLIP-seq
MIRT821527	hsa-miR-4731-5p	CLIP-seq
MIRT2181622	hsa-miR-4740-3p	CLIP-seq
MIRT2485171	hsa-miR-4747-5p	CLIP-seq
MIRT2485173	hsa-miR-4755-3p	CLIP-seq
MIRT2485174	hsa-miR-4763-5p	CLIP-seq
MIRT2485175	hsa-miR-511	CLIP-seq
MIRT2485177	hsa-miR-938	CLIP-seq

Show/Hide all (22)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	18654987, 32296183, 33961781, 35271311
GO:0005737	Component	Cytoplasm	IEA
GO:0005856	Component	Cytoskeleton	IEA
GO:0006897	Process	Endocytosis	IBA
GO:0006897	Process	Endocytosis	IEA
GO:0007015	Process	Actin filament organization	NAS	11274158
GO:0008093	Function	Cytoskeletal anchor activity	NAS	11274158
GO:0008104	Process	Intracellular protein localization	IMP	11274158
GO:0008289	Function	Lipid binding	IBA
GO:0009826	Process	Unidimensional cell growth	IMP	11274158
GO:0010591	Process	Regulation of lamellipodium assembly	IEA
GO:0014839	Process	Myoblast migration involved in skeletal muscle regeneration	IEA
GO:0015629	Component	Actin cytoskeleton	IBA
GO:0015629	Component	Actin cytoskeleton	IEA
GO:0043403	Process	Skeletal muscle tissue regeneration	IEA
GO:0048589	Process	Developmental growth	IEA
GO:0048741	Process	Skeletal muscle fiber development	IEA
GO:0051301	Process	Cell division	IEA
GO:0051666	Process	Actin cortical patch localization	IBA
GO:0051666	Process	Actin cortical patch localization	IEA
GO:0061640	Process	Cytoskeleton-dependent cytokinesis	NAS	11274158
GO:0097320	Process	Plasma membrane tubulation	IBA

MIM	HGNC	e!Ensembl
606396	1054	ENSG00000147439

Q9NQY0

Protein name

Bridging integrator 3

Protein function

Involved in cytokinesis and septation where it has a role in the localization of F-actin.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF03114	BAR	10 → 225	BAR domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Ubiquitously expressed except in brain. {ECO:0000269|PubMed:11274158}.

Sequence

MSWIPFKIGQPKKQIVPKTVERDFEREYGKLQQLEEQTRRLQKDMKKSTDADLAMSKSAV
KISLDLLSNPLCEQDQDLLNMVTALDTAMKRMDAFNQEKVNQIQKTVIEPLKKFGSVFPS
LNMAVKRREQALQDYRRLQAKVEKYEEKEKTGPVLAKLHQAREELRPVREDFEAKNRQLL
EEMPRFYGSRLDYFQPSFESLIRAQVVYYSEMHKIFGDLSHQLDQPGHSDEQRERENEAK
LSELRALSIVADD

Sequence length

253

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (9)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BREAST CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CATARACT	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OTOSCLEROSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POST-TRAUMATIC STRESS DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (5)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Carcinogenesis	Carcinogenesis	Pubtator	36068491	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	36475339	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	35915159	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	GWASCAT_DG	28892059		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	BEFREE	30740124		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

BIN3 (bridging integrator 3)