Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	55897
Gene name	Mesoderm posterior bHLH transcription factor 1
Gene symbol	MESP1
Synonyms (NCBI Gene)	bHLHc5
Chromosome	15
Chromosome location	15q26.1

Show/Hide all (23)

miRTarBase ID	miRNA	Experiments
MIRT2040776	hsa-miR-1236	CLIP-seq
MIRT2040777	hsa-miR-23a	CLIP-seq
MIRT2040778	hsa-miR-23b	CLIP-seq
MIRT2040779	hsa-miR-23c	CLIP-seq
MIRT2040780	hsa-miR-2682	CLIP-seq
MIRT2040781	hsa-miR-346	CLIP-seq
MIRT2040782	hsa-miR-3714	CLIP-seq
MIRT2040783	hsa-miR-449c	CLIP-seq
MIRT2040784	hsa-miR-4712-5p	CLIP-seq
MIRT2040785	hsa-miR-4719	CLIP-seq
MIRT2040786	hsa-miR-513b	CLIP-seq
MIRT2040787	hsa-miR-548an	CLIP-seq
MIRT2040788	hsa-miR-582-5p	CLIP-seq
MIRT2040789	hsa-miR-622	CLIP-seq
MIRT2040790	hsa-miR-665	CLIP-seq
MIRT2040791	hsa-miR-770-5p	CLIP-seq
MIRT2270473	hsa-miR-3914	CLIP-seq
MIRT2270474	hsa-miR-4480	CLIP-seq
MIRT2040784	hsa-miR-4712-5p	CLIP-seq
MIRT2040785	hsa-miR-4719	CLIP-seq
MIRT2040786	hsa-miR-513b	CLIP-seq
MIRT2040788	hsa-miR-582-5p	CLIP-seq
MIRT2040791	hsa-miR-770-5p	CLIP-seq

Show/Hide all (75)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000976	Function	Transcription cis-regulatory region binding	IDA	18297060
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0000987	Function	Cis-regulatory region sequence-specific DNA binding	IEA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA
GO:0001707	Process	Mesoderm formation	IBA
GO:0001947	Process	Heart looping	IEA
GO:0001947	Process	Heart looping	ISS
GO:0003007	Process	Heart morphogenesis	IBA
GO:0003007	Process	Heart morphogenesis	IEA
GO:0003129	Process	Heart induction	IEA
GO:0003129	Process	Heart induction	ISS
GO:0003139	Process	Secondary heart field specification	IEA
GO:0003139	Process	Secondary heart field specification	ISS
GO:0003143	Process	Embryonic heart tube morphogenesis	IEA
GO:0003143	Process	Embryonic heart tube morphogenesis	ISS
GO:0003210	Process	Cardiac atrium formation	IMP	18297060
GO:0003211	Process	Cardiac ventricle formation	IMP	18297060
GO:0003236	Process	Sinus venosus morphogenesis	IEA
GO:0003236	Process	Sinus venosus morphogenesis	ISS
GO:0003241	Process	Growth involved in heart morphogenesis	IEA
GO:0003241	Process	Growth involved in heart morphogenesis	ISS
GO:0003259	Process	Cardioblast anterior-lateral migration	IEA
GO:0003259	Process	Cardioblast anterior-lateral migration	ISS
GO:0003260	Process	Cardioblast migration	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IDA	18297060
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0005515	Function	Protein binding	IPI	32814053
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IC	18297060
GO:0005634	Component	Nucleus	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0007219	Process	Notch signaling pathway	IEA
GO:0007369	Process	Gastrulation	IEA
GO:0007369	Process	Gastrulation	ISS
GO:0008078	Process	Mesodermal cell migration	IEA
GO:0010467	Process	Gene expression	IEA
GO:0022008	Process	Neurogenesis	IMP	18297060
GO:0023019	Process	Signal transduction involved in regulation of gene expression	IEA
GO:0032525	Process	Somite rostral/caudal axis specification	IBA
GO:0042662	Process	Negative regulation of mesodermal cell fate specification	IEA
GO:0042662	Process	Negative regulation of mesodermal cell fate specification	ISS
GO:0042664	Process	Negative regulation of endodermal cell fate specification	IEA
GO:0042664	Process	Negative regulation of endodermal cell fate specification	ISS
GO:0045446	Process	Endothelial cell differentiation	IMP	18297060
GO:0045747	Process	Positive regulation of Notch signaling pathway	IEA
GO:0045747	Process	Positive regulation of Notch signaling pathway	ISS
GO:0045892	Process	Negative regulation of DNA-templated transcription	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	ISS
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	ISS
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	18297060
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	ISS
GO:0046983	Function	Protein dimerization activity	IEA
GO:0048368	Process	Lateral mesoderm development	IEA
GO:0048368	Process	Lateral mesoderm development	ISS
GO:0051155	Process	Positive regulation of striated muscle cell differentiation	IEA
GO:0051155	Process	Positive regulation of striated muscle cell differentiation	ISS
GO:0055007	Process	Cardiac muscle cell differentiation	IMP	18297060
GO:0060913	Process	Cardiac cell fate determination	IEA
GO:0060913	Process	Cardiac cell fate determination	ISS
GO:0060921	Process	Sinoatrial node cell differentiation	IMP	18297060
GO:0060947	Process	Cardiac vascular smooth muscle cell differentiation	IMP	18297060
GO:0060975	Process	Cardioblast migration to the midline involved in heart field formation	IEA
GO:0060975	Process	Cardioblast migration to the midline involved in heart field formation	ISS
GO:0070368	Process	Positive regulation of hepatocyte differentiation	IEA
GO:0070368	Process	Positive regulation of hepatocyte differentiation	ISS
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IEA
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	ISS
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IEA

MIM	HGNC	e!Ensembl
608689	29658	ENSG00000166823

Q9BRJ9

Protein name

Mesoderm posterior protein 1 (Class C basic helix-loop-helix protein 5) (bHLHc5)

Protein function

Transcription factor. Plays a role in the epithelialization of somitic mesoderm and in the development of cardiac mesoderm. Defines the rostrocaudal patterning of the somites by participating in distinct Notch pathways (By similarity). {ECO:0000

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00010	HLH	83 → 137	Helix-loop-helix DNA-binding domain	Domain

Sequence

MAQPLCPPLSESWMLSAAWGPTRRPPPSDKDCGRSLVSSPDSWGSTPADSPVASPARPGT
LRDPRAPSVGRRGARSSRLGSGQRQSASEREKLRMRTLARALHELRRFLPPSVAPAGQSL
TKIETLRLAIRYIGHLSAVLGLSEESLQRRCRQRGDAGSPRGCPLCPDDCPAQMQTRTQA
EGQGQGRGLGLVSAVRAGASWGSPPACPGARAAPEPRDPPALFAEAACPEGQAMEPSPPS
PLLPGDVLALLETWMPLSPLEWLPEEPK

Sequence length

268

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (6)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Clear cell carcinoma of kidney	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congenital heart disease	Uncertain significance	ClinVar ClinGen, Disgenet ClinGen, Disgenet	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Familial cancer of breast	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MESP1-related disorder	Benign; Likely benign; Conflicting classifications of pathogenicity; Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (12)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Carcinoma of lung	Lung carcinoma	BEFREE	31761621		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Heart Defects	Congenital heart defects	BEFREE	26694203		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital heart disease	Congenital Heart Disease	BEFREE	24056064		★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Coronary heart disease	Coronary Heart Disease	BEFREE	26694203, 28677747		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	33221518	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Double Outlet Right Ventricle	Double Outlet Right Ventricle	BEFREE	28677747		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	25069679		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	31761621		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	31761621		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	31761621		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	31761621		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ventricular Septal Defects	Ventricular septal defect	BEFREE	26694203, 28677747		★★★★★ ★☆☆☆☆ Found in Text Mining only

MESP1 (mesoderm posterior bHLH transcription factor 1)