ZKSCAN7 (zinc finger with KRAB and SCAN domains 7)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID 55888
Gene name Zinc finger with KRAB and SCAN domains 7
Gene symbol ZKSCAN7
Synonyms (NCBI Gene)
ZFPZNF167ZNF448ZNF64ZSCAN39
Chromosome 3
Chromosome location 3p21.31
miRNA miRNA information provided by mirtarbase database.
2
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (2)
miRTarBase ID miRNA Experiments Reference
MIRT029900 hsa-miR-26b-5p Microarray 19088304
MIRT051676 hsa-let-7e-5p CLASH 23622248
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
11
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all (11)
GO ID Ontology Definition Evidence Reference
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0003677 Function DNA binding IEA
GO:0005515 Function Protein binding IPI 16189514, 25416956, 26871637, 31515488, 32296183
GO:0005634 Component Nucleus IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9P0L1
Protein name Zinc finger protein with KRAB and SCAN domains 7 (Zinc finger protein 167) (Zinc finger protein 448) (Zinc finger protein 64)
Protein function May be involved in transcriptional regulation.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02023 SCAN 50 → 139 SCAN domain Domain
PF01352 KRAB 230 → 270 KRAB box Family
PF00096 zf-C2H2 383 → 405 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 411 → 433 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 439 → 461 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 467 → 489 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 495 → 517 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 523 → 545 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 551 → 573 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 579 → 601 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 607 → 629 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 635 → 657 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 663 → 685 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 691 → 713 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 719 → 741 Zinc finger, C2H2 type Domain
Sequence 
MTTAGRGNLGLIPRSTAFQKQEGRLTVKQEPANQTWGQGSSLQKNYPPVCEIFRLHFRQL
CYHEMSGPQEALSRLRELCRWWLMPEVHTKEQILELLVLEQFLSILPGELRTWVQLHHPE
SGEEAVAVVEDFQRHLSGSEEVSAPAQKQEMHFEETTALGTTKESPPTSPLSGGSAPGAH
LEPPYDPGTHHLPSGDFAQCTSPVPTLPQVGNSGDQAGATVLRMVRPQDTVAYEDLSVDY
TQKKWKSLTLSQRALQWNMMPENHHSMASLAGENMMKGSELTPKQEFFKGSESSNRTSGG
LFGVVPGAAETGDVCEDTFKELEGQTSDEEGSRLENDFLEITDEDKKKSTKDRYDKYKEV
GEHPPLSSSPVEHEGVLKGQKSYRCDECGKAFNRSSHLIGHQRIHTGEKPYECNECGKTF
RQTSQLIVHLRTHTGEKPYECSECGKAYRHSSHLIQHQRLHNGEKPYKCNECAKAFTQSS
RLTDHQRTHTGEKPYECNECGEAFIRSKSLARHQVLHTGKKPYKCNECGRAFCSNRNLID
HQRIHTGEKPYECSECGKAFSRSKCLIRHQSLHTGEKPYKCSECGKAFNQNSQLIEHERI
HTGEKPFECSECGKAFGLSKCLIRHQRLHTGEKPYKCNECGKSFNQNSHLIIHQRIHTGE
KPYECNECGKVFSYSSSLMVHQRTHTGEKPYKCNDCGKAFSDSSQLIVHQRVHTGEKPYE
CSECGKAFSQRSTFNHHQRTHTGEKSSGLAWSVS
Sequence length 754
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  Reactome
    Generic Transcription Pathway
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Show/Hide Unknown Diseases (1)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
MAJOR DEPRESSIVE DISORDER — GWAS catalog
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Show/Hide Text Mining Associations (8)
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Amyotrophic Lateral Sclerosis Amyotrophic Lateral Sclerosis BEFREE 21864053
★★★★★
★☆☆☆☆
Found in Text Mining only
Aortic Stenosis Supravalvular Aortic stenosis Pubtator 22891920 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only
Congestive heart failure Congestive Heart Failure BEFREE 22828502
★★★★★
★☆☆☆☆
Found in Text Mining only
Heart failure Heart Failure BEFREE 22828502
★★★★★
★☆☆☆☆
Found in Text Mining only
Migraine Disorders Migraine BEFREE 31784501
★★★★★
★☆☆☆☆
Found in Text Mining only
Neoplasms Neoplasms BEFREE 25360542
★★★★★
★☆☆☆☆
Found in Text Mining only
Neuroblastoma Neuroblastoma BEFREE 16731852
★★★★★
★☆☆☆☆
Found in Text Mining only
Ovarian Neoplasms Ovarian neoplasm Pubtator 23314702 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only