SLC22A11 (solute carrier family 22 member 11)

Gene

• Entrez ID: 55867
• Gene name: Solute carrier family 22 member 11
• Gene symbol: SLC22A11
• Synonyms (NCBI Gene): OAT4, hOAT4
• Chromosome: 11
• Chromosome location: 11q13.1
• Summary: The protein encoded by this gene is involved in the sodium-independent transport and excretion of organic anions, some of which are potentially toxic. The encoded protein is an integral membrane protein and is found mainly in the kidney and in the placent

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1354297	hsa-miR-1207-5p	CLIP-seq
MIRT1354298	hsa-miR-1321	CLIP-seq
MIRT1354299	hsa-miR-22	CLIP-seq
MIRT1354300	hsa-miR-3153	CLIP-seq
MIRT1354301	hsa-miR-3160-3p	CLIP-seq
MIRT1354302	hsa-miR-3190	CLIP-seq
MIRT1354303	hsa-miR-4487	CLIP-seq
MIRT1354304	hsa-miR-4728-5p	CLIP-seq
MIRT1354305	hsa-miR-4736	CLIP-seq
MIRT1354306	hsa-miR-4739	CLIP-seq
MIRT1354307	hsa-miR-4756-5p	CLIP-seq
MIRT1354308	hsa-miR-4763-3p	CLIP-seq
MIRT1354309	hsa-miR-558	CLIP-seq
MIRT1354310	hsa-miR-671-5p	CLIP-seq
MIRT2104819	hsa-miR-1254	CLIP-seq
MIRT2104820	hsa-miR-3116	CLIP-seq
MIRT2104821	hsa-miR-661	CLIP-seq
MIRT2329437	hsa-miR-922	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005452	Function	Solute:inorganic anion antiporter activity	IDA	15037815
GO:0005515	Function	Protein binding	IPI	16236806
GO:0005886	Component	Plasma membrane	IDA	10660625
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0008514	Function	Organic anion transmembrane transporter activity	IDA	11907186, 15102942, 15291761, 18501590
GO:0009897	Component	External side of plasma membrane	IDA	15102942
GO:0009925	Component	Basal plasma membrane	IEA
GO:0015132	Function	Prostaglandin transmembrane transporter activity	IDA	11907186
GO:0015297	Function	Antiporter activity	IEA
GO:0015347	Function	Sodium-independent organic anion transmembrane transporter activity	IDA	10660625
GO:0015347	Function	Sodium-independent organic anion transmembrane transporter activity	TAS
GO:0015698	Process	Inorganic anion transport	IEA
GO:0015711	Process	Organic anion transport	IBA
GO:0015711	Process	Organic anion transport	IDA	10660625, 15291761
GO:0015732	Process	Prostaglandin transport	IDA	11907186
GO:0016020	Component	Membrane	IEA
GO:0016324	Component	Apical plasma membrane	IDA	15037815
GO:0016324	Component	Apical plasma membrane	IEA
GO:0022857	Function	Transmembrane transporter activity	IEA
GO:0046415	Process	Urate metabolic process	IMP	19503597
GO:0055085	Process	Transmembrane transport	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867

Other IDs

• MIM: 607097
• HGNC: 18120
• e!Ensembl: ENSG00000168065

Protein

• UniProt ID: Q9NSA0
• Protein name: Solute carrier family 22 member 11 (Organic anion transporter 4) (OAT4) (Organic anion:dicarboxylate exchanger OAT4)
• Protein function: Antiporter that mediates the transport of conjugated steroids and other specific organic anions at the basal membrane of syncytiotrophoblast and at the apical membrane of proximal tubule epithelial cells, in exchange for anionic compounds (PubMe
• PDB: 8WJH
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00083	Sugar_tr	103 → 526	Sugar (and other) transporter	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in placental trophoblasts, syncytiotrophoblast and cytotrophoblast (PubMed:10660625, PubMed:12409283, PubMed:26277985). Also located in the proximal tubules in kidneys (PubMed:10660625, PubMed:15037815, PubMed:26277985). {ECO
• Sequence:

  MAFSKLLEQAGGVGLFQTLQVLTFILPCLMIPSQMLLENFSAAIPGHRCWTHMLDNGSAV
  STNMTPKALLTISIPPGPNQGPHQCRRFRQPQWQLLDPNATATSWSEADTEPCVDGWVYD
  RSVFTSTIVAKWDLVCSSQGLKPLSQSIFMSGILVGSFIWGLLSYRFGRKPMLSWCCLQL
  AVAGTSTIFAPTFVIYCGLRFVAAFGMAGIFLSSLTLMVEWTTTSRRAVTMTVVGCAFSA
  GQAALGGLAFALRDWRTLQLAASVPFFAISLISWWLPESARWLIIKGKPDQALQELRKVA
  RINGHKEAKNLTIEVLMSSVKEEVASAKEPRSVLDLFCVPVLRWRSCAMLVVNFSLLISY
  YGLVFDLQSLGRDIFLLQALFGAVDFLGRATTALLLSFLGRRTIQAGSQAMAGLAILANM
  LVPQDLQTLRVVFAVLGKGCFGISLTCLTIYKAELFPTPVRMTADGILHTVGRLGAMMGP
  LILMSRQALPLLPPLLYGVISIASSLVVLFFLPETQGLPLPDTIQDLESQKSTAAQGNRQ
  EAVTVESTSL

• Sequence length: 550

Pathways

Reactome:

Organic anion transport

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
GOUT	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IGA GLOMERULONEPHRITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OLIGODENDROGLIOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SLC22A11-related disorder	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Alzheimer Disease	Alzheimer disease	Pubtator	40023574	Inhibit	★☆☆☆☆ Found in Text Mining only
Arthritis, Gouty	Gouty arthritis	GWASDB_DG	20884846, 23263486		★☆☆☆☆ Found in Text Mining only
Arthritis, Gouty	Gouty arthritis	GWASCAT_DG	20884846		★☆☆☆☆ Found in Text Mining only
Glycosuria Renal	Renal glycosuria	Pubtator	24025986	Associate	★☆☆☆☆ Found in Text Mining only
Gout	Gout	GWASDB_DG	20884846, 23263486		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gout	Gout	GWASCAT_DG	20884846		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gout	Gout	Pubtator	24025986, 24360580, 26290326, 38222853	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperuricemia	Hyperuricemia	LHGDN	17229912		★☆☆☆☆ Found in Text Mining only
Hyperuricemia	Hyperuricemia	Pubtator	38222853	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	40023574	Inhibit	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	23934321		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	18414001		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	LHGDN	18414001		★☆☆☆☆ Found in Text Mining only