PKN2 (protein kinase N2)

Gene

• Entrez ID: 5586
• Gene name: Protein kinase N2
• Gene symbol: PKN2
• Synonyms (NCBI Gene): PAK2, PRK2, PRKCL2, PRO2042, Pak-2, STK7
• Chromosome: 1
• Chromosome location: 1p22.2

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT001524	hsa-miR-155-5p	pSILAC	18668040
MIRT001524	hsa-miR-155-5p	Reporter assay;Other	20584899
MIRT001524	hsa-miR-155-5p	Proteomics	18668040
MIRT655058	hsa-miR-548ae-3p	HITS-CLIP	23824327
MIRT655057	hsa-miR-548ah-3p	HITS-CLIP	23824327
MIRT655056	hsa-miR-548aj-3p	HITS-CLIP	23824327
MIRT655055	hsa-miR-548am-3p	HITS-CLIP	23824327
MIRT655054	hsa-miR-548aq-3p	HITS-CLIP	23824327
MIRT655053	hsa-miR-548j-3p	HITS-CLIP	23824327
MIRT655052	hsa-miR-548x-3p	HITS-CLIP	23824327
MIRT655051	hsa-miR-5582-3p	HITS-CLIP	23824327
MIRT655050	hsa-miR-6768-5p	HITS-CLIP	23824327
MIRT655049	hsa-miR-16-1-3p	HITS-CLIP	23824327
MIRT655048	hsa-miR-1284	HITS-CLIP	23824327
MIRT655047	hsa-miR-26a-1-3p	HITS-CLIP	23824327
MIRT655046	hsa-miR-26a-2-3p	HITS-CLIP	23824327
MIRT655045	hsa-miR-4797-3p	HITS-CLIP	23824327
MIRT655044	hsa-miR-4264	HITS-CLIP	23824327
MIRT149009	hsa-miR-4672	HITS-CLIP	23824327
MIRT655043	hsa-miR-4789-5p	HITS-CLIP	23824327
MIRT655042	hsa-miR-337-3p	HITS-CLIP	23824327
MIRT655041	hsa-miR-202-5p	HITS-CLIP	23824327
MIRT080899	hsa-miR-5692a	PAR-CLIP	21572407
MIRT555572	hsa-miR-7109-3p	PAR-CLIP	21572407
MIRT080898	hsa-miR-4795-5p	PAR-CLIP	21572407
MIRT080896	hsa-miR-3616-5p	PAR-CLIP	21572407
MIRT080893	hsa-miR-573	PAR-CLIP	21572407
MIRT555571	hsa-let-7c-3p	PAR-CLIP	21572407
MIRT001524	hsa-miR-155-5p	HITS-CLIP	22473208
MIRT001524	hsa-miR-155-5p	HITS-CLIP	22473208
MIRT655058	hsa-miR-548ae-3p	HITS-CLIP	23824327
MIRT655057	hsa-miR-548ah-3p	HITS-CLIP	23824327
MIRT655056	hsa-miR-548aj-3p	HITS-CLIP	23824327
MIRT655055	hsa-miR-548am-3p	HITS-CLIP	23824327
MIRT655054	hsa-miR-548aq-3p	HITS-CLIP	23824327
MIRT655053	hsa-miR-548j-3p	HITS-CLIP	23824327
MIRT655052	hsa-miR-548x-3p	HITS-CLIP	23824327
MIRT655051	hsa-miR-5582-3p	HITS-CLIP	23824327
MIRT655050	hsa-miR-6768-5p	HITS-CLIP	23824327
MIRT655049	hsa-miR-16-1-3p	HITS-CLIP	23824327
MIRT655048	hsa-miR-1284	HITS-CLIP	23824327
MIRT655047	hsa-miR-26a-1-3p	HITS-CLIP	23824327
MIRT655046	hsa-miR-26a-2-3p	HITS-CLIP	23824327
MIRT655045	hsa-miR-4797-3p	HITS-CLIP	23824327
MIRT655044	hsa-miR-4264	HITS-CLIP	23824327
MIRT149009	hsa-miR-4672	HITS-CLIP	23824327
MIRT655043	hsa-miR-4789-5p	HITS-CLIP	23824327
MIRT655042	hsa-miR-337-3p	HITS-CLIP	23824327
MIRT655041	hsa-miR-202-5p	HITS-CLIP	23824327
MIRT080899	hsa-miR-5692a	PAR-CLIP	21572407
MIRT555572	hsa-miR-7109-3p	PAR-CLIP	21572407
MIRT080898	hsa-miR-4795-5p	PAR-CLIP	21572407
MIRT080896	hsa-miR-3616-5p	PAR-CLIP	21572407
MIRT080893	hsa-miR-573	PAR-CLIP	21572407
MIRT555571	hsa-let-7c-3p	PAR-CLIP	21572407
MIRT1237744	hsa-let-7a	CLIP-seq
MIRT1237745	hsa-let-7b	CLIP-seq
MIRT1237746	hsa-let-7c	CLIP-seq
MIRT1237747	hsa-let-7d	CLIP-seq
MIRT1237748	hsa-let-7e	CLIP-seq
MIRT1237749	hsa-let-7f	CLIP-seq
MIRT1237750	hsa-let-7g	CLIP-seq
MIRT1237751	hsa-let-7i	CLIP-seq
MIRT1237752	hsa-miR-101	CLIP-seq
MIRT1237753	hsa-miR-105	CLIP-seq
MIRT1237754	hsa-miR-1200	CLIP-seq
MIRT1237755	hsa-miR-1256	CLIP-seq
MIRT1237756	hsa-miR-1287	CLIP-seq
MIRT1237757	hsa-miR-1304	CLIP-seq
MIRT1237758	hsa-miR-144	CLIP-seq
MIRT1237759	hsa-miR-151-3p	CLIP-seq
MIRT1237760	hsa-miR-155	CLIP-seq
MIRT1237761	hsa-miR-183	CLIP-seq
MIRT1237762	hsa-miR-186	CLIP-seq
MIRT1237763	hsa-miR-202	CLIP-seq
MIRT1237764	hsa-miR-204	CLIP-seq
MIRT1237765	hsa-miR-211	CLIP-seq
MIRT1237766	hsa-miR-223	CLIP-seq
MIRT1237767	hsa-miR-27a	CLIP-seq
MIRT1237768	hsa-miR-27b	CLIP-seq
MIRT1237769	hsa-miR-300	CLIP-seq
MIRT1237770	hsa-miR-3122	CLIP-seq
MIRT1237771	hsa-miR-3124-3p	CLIP-seq
MIRT1237772	hsa-miR-3135b	CLIP-seq
MIRT1237773	hsa-miR-3145-3p	CLIP-seq
MIRT1237774	hsa-miR-3162-3p	CLIP-seq
MIRT1237775	hsa-miR-3163	CLIP-seq
MIRT1237776	hsa-miR-3187-3p	CLIP-seq
MIRT1237777	hsa-miR-323-3p	CLIP-seq
MIRT1237778	hsa-miR-338-5p	CLIP-seq
MIRT1237779	hsa-miR-346	CLIP-seq
MIRT1237780	hsa-miR-3609	CLIP-seq
MIRT1237781	hsa-miR-3613-3p	CLIP-seq
MIRT1237782	hsa-miR-3647-5p	CLIP-seq
MIRT1237783	hsa-miR-3662	CLIP-seq
MIRT1237784	hsa-miR-3667-3p	CLIP-seq
MIRT1237785	hsa-miR-381	CLIP-seq
MIRT1237786	hsa-miR-3913-5p	CLIP-seq
MIRT1237787	hsa-miR-3920	CLIP-seq
MIRT1237788	hsa-miR-3945	CLIP-seq
MIRT1237789	hsa-miR-409-5p	CLIP-seq
MIRT1237790	hsa-miR-4252	CLIP-seq
MIRT1237791	hsa-miR-4263	CLIP-seq
MIRT1237792	hsa-miR-4288	CLIP-seq
MIRT1237793	hsa-miR-4305	CLIP-seq
MIRT1237794	hsa-miR-4324	CLIP-seq
MIRT1237795	hsa-miR-4325	CLIP-seq
MIRT1237796	hsa-miR-4326	CLIP-seq
MIRT1237797	hsa-miR-4328	CLIP-seq
MIRT1237798	hsa-miR-4435	CLIP-seq
MIRT1237799	hsa-miR-4436b-5p	CLIP-seq
MIRT1237800	hsa-miR-4458	CLIP-seq
MIRT1237801	hsa-miR-4463	CLIP-seq
MIRT1237802	hsa-miR-4468	CLIP-seq
MIRT1237803	hsa-miR-4470	CLIP-seq
MIRT1237804	hsa-miR-4495	CLIP-seq
MIRT1237805	hsa-miR-4499	CLIP-seq
MIRT1237806	hsa-miR-4500	CLIP-seq
MIRT1237807	hsa-miR-452	CLIP-seq
MIRT1237808	hsa-miR-4639-5p	CLIP-seq
MIRT1237809	hsa-miR-4653-3p	CLIP-seq
MIRT1237810	hsa-miR-4666-3p	CLIP-seq
MIRT1237811	hsa-miR-4666-5p	CLIP-seq
MIRT1237812	hsa-miR-4676-3p	CLIP-seq
MIRT1237813	hsa-miR-4697-3p	CLIP-seq
MIRT1237814	hsa-miR-4700-3p	CLIP-seq
MIRT1237815	hsa-miR-4701-5p	CLIP-seq
MIRT1237816	hsa-miR-4703-3p	CLIP-seq
MIRT1237817	hsa-miR-4720-5p	CLIP-seq
MIRT1237818	hsa-miR-4725-5p	CLIP-seq
MIRT1237819	hsa-miR-4755-5p	CLIP-seq
MIRT1237820	hsa-miR-4761-5p	CLIP-seq
MIRT1237821	hsa-miR-4796-3p	CLIP-seq
MIRT1237822	hsa-miR-4799-3p	CLIP-seq
MIRT1237823	hsa-miR-4799-5p	CLIP-seq
MIRT1237824	hsa-miR-504	CLIP-seq
MIRT1237825	hsa-miR-5095	CLIP-seq
MIRT1237826	hsa-miR-511	CLIP-seq
MIRT1237827	hsa-miR-513a-5p	CLIP-seq
MIRT1237828	hsa-miR-524-3p	CLIP-seq
MIRT1237829	hsa-miR-525-3p	CLIP-seq
MIRT1237830	hsa-miR-544b	CLIP-seq
MIRT1237831	hsa-miR-548aa	CLIP-seq
MIRT1237832	hsa-miR-548ah	CLIP-seq
MIRT1237833	hsa-miR-548s	CLIP-seq
MIRT1237834	hsa-miR-548t	CLIP-seq
MIRT1237835	hsa-miR-552	CLIP-seq
MIRT1237836	hsa-miR-576-5p	CLIP-seq
MIRT1237837	hsa-miR-582-3p	CLIP-seq
MIRT1237838	hsa-miR-582-5p	CLIP-seq
MIRT1237839	hsa-miR-584	CLIP-seq
MIRT1237840	hsa-miR-588	CLIP-seq
MIRT1237841	hsa-miR-600	CLIP-seq
MIRT1237842	hsa-miR-623	CLIP-seq
MIRT1237843	hsa-miR-626	CLIP-seq
MIRT1237844	hsa-miR-632	CLIP-seq
MIRT1237845	hsa-miR-659	CLIP-seq
MIRT1237846	hsa-miR-892a	CLIP-seq
MIRT1237847	hsa-miR-98	CLIP-seq
MIRT1552325	hsa-miR-1208	CLIP-seq
MIRT1552326	hsa-miR-143	CLIP-seq
MIRT1552327	hsa-miR-3121-3p	CLIP-seq
MIRT1552328	hsa-miR-3658	CLIP-seq
MIRT1552329	hsa-miR-3670	CLIP-seq
MIRT1552330	hsa-miR-4770	CLIP-seq
MIRT1552331	hsa-miR-556-5p	CLIP-seq
MIRT1237744	hsa-let-7a	CLIP-seq
MIRT1237745	hsa-let-7b	CLIP-seq
MIRT1237746	hsa-let-7c	CLIP-seq
MIRT1237747	hsa-let-7d	CLIP-seq
MIRT1237748	hsa-let-7e	CLIP-seq
MIRT1237749	hsa-let-7f	CLIP-seq
MIRT1237750	hsa-let-7g	CLIP-seq
MIRT1237751	hsa-let-7i	CLIP-seq
MIRT1237752	hsa-miR-101	CLIP-seq
MIRT1237753	hsa-miR-105	CLIP-seq
MIRT1237754	hsa-miR-1200	CLIP-seq
MIRT2069893	hsa-miR-124	CLIP-seq
MIRT2069894	hsa-miR-1279	CLIP-seq
MIRT1237757	hsa-miR-1304	CLIP-seq
MIRT2069895	hsa-miR-137	CLIP-seq
MIRT1237758	hsa-miR-144	CLIP-seq
MIRT2069896	hsa-miR-1825	CLIP-seq
MIRT1237761	hsa-miR-183	CLIP-seq
MIRT2069897	hsa-miR-199a-5p	CLIP-seq
MIRT2069898	hsa-miR-199b-5p	CLIP-seq
MIRT1237763	hsa-miR-202	CLIP-seq
MIRT2069899	hsa-miR-296-3p	CLIP-seq
MIRT1552327	hsa-miR-3121-3p	CLIP-seq
MIRT1237771	hsa-miR-3124-3p	CLIP-seq
MIRT1237772	hsa-miR-3135b	CLIP-seq
MIRT2069900	hsa-miR-3140-3p	CLIP-seq
MIRT2069901	hsa-miR-3150b-3p	CLIP-seq
MIRT2069902	hsa-miR-3157-3p	CLIP-seq
MIRT2069903	hsa-miR-3160-5p	CLIP-seq
MIRT1237775	hsa-miR-3163	CLIP-seq
MIRT2069904	hsa-miR-3179	CLIP-seq
MIRT1237778	hsa-miR-338-5p	CLIP-seq
MIRT1237779	hsa-miR-346	CLIP-seq
MIRT2069905	hsa-miR-3591-5p	CLIP-seq
MIRT2069906	hsa-miR-3606	CLIP-seq
MIRT1237781	hsa-miR-3613-3p	CLIP-seq
MIRT2069907	hsa-miR-3613-5p	CLIP-seq
MIRT2069908	hsa-miR-3646	CLIP-seq
MIRT1552328	hsa-miR-3658	CLIP-seq
MIRT1237784	hsa-miR-3667-3p	CLIP-seq
MIRT1237788	hsa-miR-3945	CLIP-seq
MIRT2069909	hsa-miR-409-3p	CLIP-seq
MIRT1237789	hsa-miR-409-5p	CLIP-seq
MIRT2069910	hsa-miR-4255	CLIP-seq
MIRT1237792	hsa-miR-4288	CLIP-seq
MIRT2069911	hsa-miR-4290	CLIP-seq
MIRT2069912	hsa-miR-4297	CLIP-seq
MIRT1237794	hsa-miR-4324	CLIP-seq
MIRT1237795	hsa-miR-4325	CLIP-seq
MIRT1237799	hsa-miR-4436b-5p	CLIP-seq
MIRT2069913	hsa-miR-4453	CLIP-seq
MIRT1237800	hsa-miR-4458	CLIP-seq
MIRT1237803	hsa-miR-4470	CLIP-seq
MIRT2069914	hsa-miR-4473	CLIP-seq
MIRT1237804	hsa-miR-4495	CLIP-seq
MIRT1237806	hsa-miR-4500	CLIP-seq
MIRT2069915	hsa-miR-4538	CLIP-seq
MIRT1237809	hsa-miR-4653-3p	CLIP-seq
MIRT2069916	hsa-miR-4659a-3p	CLIP-seq
MIRT2069917	hsa-miR-4659b-3p	CLIP-seq
MIRT2069918	hsa-miR-4671-3p	CLIP-seq
MIRT2069919	hsa-miR-4689	CLIP-seq
MIRT2069920	hsa-miR-4699-3p	CLIP-seq
MIRT2069921	hsa-miR-4709-3p	CLIP-seq
MIRT1237818	hsa-miR-4725-5p	CLIP-seq
MIRT2069922	hsa-miR-4735-5p	CLIP-seq
MIRT2069923	hsa-miR-4760-3p	CLIP-seq
MIRT2069924	hsa-miR-4775	CLIP-seq
MIRT2069925	hsa-miR-4778-3p	CLIP-seq
MIRT2069926	hsa-miR-4784	CLIP-seq
MIRT2069927	hsa-miR-488	CLIP-seq
MIRT1237824	hsa-miR-504	CLIP-seq
MIRT2069928	hsa-miR-506	CLIP-seq
MIRT2069929	hsa-miR-512-3p	CLIP-seq
MIRT2069930	hsa-miR-520f	CLIP-seq
MIRT1237828	hsa-miR-524-3p	CLIP-seq
MIRT1237829	hsa-miR-525-3p	CLIP-seq
MIRT1237830	hsa-miR-544b	CLIP-seq
MIRT2069931	hsa-miR-548ae	CLIP-seq
MIRT2069932	hsa-miR-548aj	CLIP-seq
MIRT2069933	hsa-miR-548am	CLIP-seq
MIRT2069934	hsa-miR-548an	CLIP-seq
MIRT2069935	hsa-miR-548x	CLIP-seq
MIRT1237836	hsa-miR-576-5p	CLIP-seq
MIRT2069936	hsa-miR-578	CLIP-seq
MIRT2069937	hsa-miR-579	CLIP-seq
MIRT2069938	hsa-miR-580	CLIP-seq
MIRT2069939	hsa-miR-581	CLIP-seq
MIRT1237839	hsa-miR-584	CLIP-seq
MIRT2069940	hsa-miR-590-3p	CLIP-seq
MIRT1237844	hsa-miR-632	CLIP-seq
MIRT2069941	hsa-miR-636	CLIP-seq
MIRT2069942	hsa-miR-874	CLIP-seq
MIRT1237847	hsa-miR-98	CLIP-seq
MIRT1237744	hsa-let-7a	CLIP-seq
MIRT1237745	hsa-let-7b	CLIP-seq
MIRT1237746	hsa-let-7c	CLIP-seq
MIRT1237747	hsa-let-7d	CLIP-seq
MIRT1237748	hsa-let-7e	CLIP-seq
MIRT1237749	hsa-let-7f	CLIP-seq
MIRT1237750	hsa-let-7g	CLIP-seq
MIRT1237751	hsa-let-7i	CLIP-seq
MIRT1237754	hsa-miR-1200	CLIP-seq
MIRT1237757	hsa-miR-1304	CLIP-seq
MIRT2297240	hsa-miR-139-5p	CLIP-seq
MIRT2297241	hsa-miR-146a	CLIP-seq
MIRT2297242	hsa-miR-146b-5p	CLIP-seq
MIRT1237760	hsa-miR-155	CLIP-seq
MIRT2069896	hsa-miR-1825	CLIP-seq
MIRT2069897	hsa-miR-199a-5p	CLIP-seq
MIRT2069898	hsa-miR-199b-5p	CLIP-seq
MIRT1237763	hsa-miR-202	CLIP-seq
MIRT1237766	hsa-miR-223	CLIP-seq
MIRT1237769	hsa-miR-300	CLIP-seq
MIRT2297243	hsa-miR-3120-3p	CLIP-seq
MIRT1552327	hsa-miR-3121-3p	CLIP-seq
MIRT2297244	hsa-miR-3166	CLIP-seq
MIRT1237776	hsa-miR-3187-3p	CLIP-seq
MIRT2069905	hsa-miR-3591-5p	CLIP-seq
MIRT1237780	hsa-miR-3609	CLIP-seq
MIRT1237781	hsa-miR-3613-3p	CLIP-seq
MIRT1237782	hsa-miR-3647-5p	CLIP-seq
MIRT1552328	hsa-miR-3658	CLIP-seq
MIRT2297245	hsa-miR-3672	CLIP-seq
MIRT2297246	hsa-miR-374a	CLIP-seq
MIRT2297247	hsa-miR-374b	CLIP-seq
MIRT1237785	hsa-miR-381	CLIP-seq
MIRT1237789	hsa-miR-409-5p	CLIP-seq
MIRT1237790	hsa-miR-4252	CLIP-seq
MIRT2069910	hsa-miR-4255	CLIP-seq
MIRT1237794	hsa-miR-4324	CLIP-seq
MIRT1237797	hsa-miR-4328	CLIP-seq
MIRT1237798	hsa-miR-4435	CLIP-seq
MIRT1237800	hsa-miR-4458	CLIP-seq
MIRT1237802	hsa-miR-4468	CLIP-seq
MIRT2297248	hsa-miR-4494	CLIP-seq
MIRT1237806	hsa-miR-4500	CLIP-seq
MIRT1237808	hsa-miR-4639-5p	CLIP-seq
MIRT1237810	hsa-miR-4666-3p	CLIP-seq
MIRT1237813	hsa-miR-4697-3p	CLIP-seq
MIRT1237815	hsa-miR-4701-5p	CLIP-seq
MIRT1237816	hsa-miR-4703-3p	CLIP-seq
MIRT2069921	hsa-miR-4709-3p	CLIP-seq
MIRT1237818	hsa-miR-4725-5p	CLIP-seq
MIRT2069923	hsa-miR-4760-3p	CLIP-seq
MIRT2297249	hsa-miR-4771	CLIP-seq
MIRT2297250	hsa-miR-4777-3p	CLIP-seq
MIRT2069925	hsa-miR-4778-3p	CLIP-seq
MIRT1237824	hsa-miR-504	CLIP-seq
MIRT1237830	hsa-miR-544b	CLIP-seq
MIRT1237831	hsa-miR-548aa	CLIP-seq
MIRT1237832	hsa-miR-548ah	CLIP-seq
MIRT2297251	hsa-miR-548n	CLIP-seq
MIRT1237833	hsa-miR-548s	CLIP-seq
MIRT1237834	hsa-miR-548t	CLIP-seq
MIRT2069936	hsa-miR-578	CLIP-seq
MIRT2069937	hsa-miR-579	CLIP-seq
MIRT2069938	hsa-miR-580	CLIP-seq
MIRT2069939	hsa-miR-581	CLIP-seq
MIRT1237839	hsa-miR-584	CLIP-seq
MIRT1237840	hsa-miR-588	CLIP-seq
MIRT2297252	hsa-miR-589	CLIP-seq
MIRT1237843	hsa-miR-626	CLIP-seq
MIRT2297253	hsa-miR-664	CLIP-seq
MIRT1237846	hsa-miR-892a	CLIP-seq
MIRT2297254	hsa-miR-922	CLIP-seq
MIRT1237847	hsa-miR-98	CLIP-seq
MIRT2392584	hsa-miR-340	CLIP-seq
MIRT2069905	hsa-miR-3591-5p	CLIP-seq
MIRT2069906	hsa-miR-3606	CLIP-seq
MIRT2069912	hsa-miR-4297	CLIP-seq
MIRT1237808	hsa-miR-4639-5p	CLIP-seq
MIRT1237818	hsa-miR-4725-5p	CLIP-seq
MIRT2069922	hsa-miR-4735-5p	CLIP-seq
MIRT2069924	hsa-miR-4775	CLIP-seq
MIRT1237824	hsa-miR-504	CLIP-seq
MIRT1237836	hsa-miR-576-5p	CLIP-seq
MIRT2069940	hsa-miR-590-3p	CLIP-seq
MIRT2432143	hsa-miR-921	CLIP-seq
MIRT2442464	hsa-miR-153	CLIP-seq
MIRT2442465	hsa-miR-4280	CLIP-seq
MIRT2069937	hsa-miR-579	CLIP-seq
MIRT2465846	hsa-miR-326	CLIP-seq
MIRT2465847	hsa-miR-330-5p	CLIP-seq
MIRT2069908	hsa-miR-3646	CLIP-seq
MIRT2465848	hsa-miR-378	CLIP-seq
MIRT2465849	hsa-miR-378b	CLIP-seq
MIRT2465850	hsa-miR-378c	CLIP-seq
MIRT2465851	hsa-miR-378d	CLIP-seq
MIRT2465852	hsa-miR-378e	CLIP-seq
MIRT2465853	hsa-miR-378f	CLIP-seq
MIRT2465854	hsa-miR-378h	CLIP-seq
MIRT2465855	hsa-miR-378i	CLIP-seq
MIRT2465856	hsa-miR-422a	CLIP-seq
MIRT2465857	hsa-miR-4638-3p	CLIP-seq
MIRT2465858	hsa-miR-4695-3p	CLIP-seq
MIRT1237744	hsa-let-7a	CLIP-seq
MIRT1237745	hsa-let-7b	CLIP-seq
MIRT1237746	hsa-let-7c	CLIP-seq
MIRT1237747	hsa-let-7d	CLIP-seq
MIRT1237748	hsa-let-7e	CLIP-seq
MIRT1237749	hsa-let-7f	CLIP-seq
MIRT1237750	hsa-let-7g	CLIP-seq
MIRT1237751	hsa-let-7i	CLIP-seq
MIRT1237752	hsa-miR-101	CLIP-seq
MIRT1237754	hsa-miR-1200	CLIP-seq
MIRT1552325	hsa-miR-1208	CLIP-seq
MIRT2069894	hsa-miR-1279	CLIP-seq
MIRT1237757	hsa-miR-1304	CLIP-seq
MIRT2594563	hsa-miR-142-5p	CLIP-seq
MIRT1552326	hsa-miR-143	CLIP-seq
MIRT1237758	hsa-miR-144	CLIP-seq
MIRT2594564	hsa-miR-145	CLIP-seq
MIRT2442464	hsa-miR-153	CLIP-seq
MIRT1237760	hsa-miR-155	CLIP-seq
MIRT2069896	hsa-miR-1825	CLIP-seq
MIRT2069897	hsa-miR-199a-5p	CLIP-seq
MIRT2069898	hsa-miR-199b-5p	CLIP-seq
MIRT1237763	hsa-miR-202	CLIP-seq
MIRT1237766	hsa-miR-223	CLIP-seq
MIRT2069899	hsa-miR-296-3p	CLIP-seq
MIRT2594565	hsa-miR-3065-5p	CLIP-seq
MIRT1552327	hsa-miR-3121-3p	CLIP-seq
MIRT1237773	hsa-miR-3145-3p	CLIP-seq
MIRT2069901	hsa-miR-3150b-3p	CLIP-seq
MIRT1237775	hsa-miR-3163	CLIP-seq
MIRT2069904	hsa-miR-3179	CLIP-seq
MIRT2594566	hsa-miR-3180-5p	CLIP-seq
MIRT2594567	hsa-miR-3185	CLIP-seq
MIRT2594568	hsa-miR-320a	CLIP-seq
MIRT2594569	hsa-miR-320b	CLIP-seq
MIRT2594570	hsa-miR-320c	CLIP-seq
MIRT2594571	hsa-miR-320d	CLIP-seq
MIRT2392584	hsa-miR-340	CLIP-seq
MIRT2069905	hsa-miR-3591-5p	CLIP-seq
MIRT1237781	hsa-miR-3613-3p	CLIP-seq
MIRT2594572	hsa-miR-3622a-3p	CLIP-seq
MIRT2594573	hsa-miR-3622b-3p	CLIP-seq
MIRT2069908	hsa-miR-3646	CLIP-seq
MIRT1552328	hsa-miR-3658	CLIP-seq
MIRT1552329	hsa-miR-3670	CLIP-seq
MIRT2594574	hsa-miR-3676	CLIP-seq
MIRT2594575	hsa-miR-3686	CLIP-seq
MIRT2594576	hsa-miR-376a	CLIP-seq
MIRT2594577	hsa-miR-376b	CLIP-seq
MIRT1237789	hsa-miR-409-5p	CLIP-seq
MIRT2594578	hsa-miR-412	CLIP-seq
MIRT2069910	hsa-miR-4255	CLIP-seq
MIRT2594579	hsa-miR-4266	CLIP-seq
MIRT2594580	hsa-miR-4275	CLIP-seq
MIRT2442465	hsa-miR-4280	CLIP-seq
MIRT2594581	hsa-miR-4282	CLIP-seq
MIRT1237794	hsa-miR-4324	CLIP-seq
MIRT1237797	hsa-miR-4328	CLIP-seq
MIRT2594582	hsa-miR-4429	CLIP-seq
MIRT1237800	hsa-miR-4458	CLIP-seq
MIRT1237806	hsa-miR-4500	CLIP-seq
MIRT1237807	hsa-miR-452	CLIP-seq
MIRT1237808	hsa-miR-4639-5p	CLIP-seq
MIRT2594583	hsa-miR-4643	CLIP-seq
MIRT2594584	hsa-miR-466	CLIP-seq
MIRT2594585	hsa-miR-4668-3p	CLIP-seq
MIRT1237812	hsa-miR-4676-3p	CLIP-seq
MIRT2069919	hsa-miR-4689	CLIP-seq
MIRT1237813	hsa-miR-4697-3p	CLIP-seq
MIRT2069920	hsa-miR-4699-3p	CLIP-seq
MIRT1237816	hsa-miR-4703-3p	CLIP-seq
MIRT2069921	hsa-miR-4709-3p	CLIP-seq
MIRT1237818	hsa-miR-4725-5p	CLIP-seq
MIRT2069922	hsa-miR-4735-5p	CLIP-seq
MIRT2594586	hsa-miR-4738-3p	CLIP-seq
MIRT2069923	hsa-miR-4760-3p	CLIP-seq
MIRT2594587	hsa-miR-4762-5p	CLIP-seq
MIRT1552330	hsa-miR-4770	CLIP-seq
MIRT2069925	hsa-miR-4778-3p	CLIP-seq
MIRT2594588	hsa-miR-4778-5p	CLIP-seq
MIRT2069926	hsa-miR-4784	CLIP-seq
MIRT2594589	hsa-miR-4789-3p	CLIP-seq
MIRT2594590	hsa-miR-4790-3p	CLIP-seq
MIRT1237823	hsa-miR-4799-5p	CLIP-seq
MIRT1237824	hsa-miR-504	CLIP-seq
MIRT1237826	hsa-miR-511	CLIP-seq
MIRT1237830	hsa-miR-544b	CLIP-seq
MIRT2594591	hsa-miR-548ac	CLIP-seq
MIRT2069931	hsa-miR-548ae	CLIP-seq
MIRT2069932	hsa-miR-548aj	CLIP-seq
MIRT2069933	hsa-miR-548am	CLIP-seq
MIRT2594592	hsa-miR-548d-3p	CLIP-seq
MIRT2594593	hsa-miR-548g	CLIP-seq
MIRT2594594	hsa-miR-548p	CLIP-seq
MIRT2069935	hsa-miR-548x	CLIP-seq
MIRT2594595	hsa-miR-548z	CLIP-seq
MIRT1552331	hsa-miR-556-5p	CLIP-seq
MIRT2069936	hsa-miR-578	CLIP-seq
MIRT2069937	hsa-miR-579	CLIP-seq
MIRT2069939	hsa-miR-581	CLIP-seq
MIRT1237838	hsa-miR-582-5p	CLIP-seq
MIRT1237839	hsa-miR-584	CLIP-seq
MIRT2069940	hsa-miR-590-3p	CLIP-seq
MIRT2594596	hsa-miR-617	CLIP-seq
MIRT1237843	hsa-miR-626	CLIP-seq
MIRT1237846	hsa-miR-892a	CLIP-seq
MIRT1237847	hsa-miR-98	CLIP-seq
MIRT1237744	hsa-let-7a	CLIP-seq
MIRT1237745	hsa-let-7b	CLIP-seq
MIRT1237746	hsa-let-7c	CLIP-seq
MIRT1237747	hsa-let-7d	CLIP-seq
MIRT1237748	hsa-let-7e	CLIP-seq
MIRT1237749	hsa-let-7f	CLIP-seq
MIRT1237750	hsa-let-7g	CLIP-seq
MIRT1237751	hsa-let-7i	CLIP-seq
MIRT1237752	hsa-miR-101	CLIP-seq
MIRT1237754	hsa-miR-1200	CLIP-seq
MIRT1552325	hsa-miR-1208	CLIP-seq
MIRT2069894	hsa-miR-1279	CLIP-seq
MIRT2594563	hsa-miR-142-5p	CLIP-seq
MIRT1552326	hsa-miR-143	CLIP-seq
MIRT1237758	hsa-miR-144	CLIP-seq
MIRT2594564	hsa-miR-145	CLIP-seq
MIRT2442464	hsa-miR-153	CLIP-seq
MIRT2069896	hsa-miR-1825	CLIP-seq
MIRT2069897	hsa-miR-199a-5p	CLIP-seq
MIRT2069898	hsa-miR-199b-5p	CLIP-seq
MIRT1237763	hsa-miR-202	CLIP-seq
MIRT2069899	hsa-miR-296-3p	CLIP-seq
MIRT1552327	hsa-miR-3121-3p	CLIP-seq
MIRT1237773	hsa-miR-3145-3p	CLIP-seq
MIRT2069901	hsa-miR-3150b-3p	CLIP-seq
MIRT1237775	hsa-miR-3163	CLIP-seq
MIRT2069904	hsa-miR-3179	CLIP-seq
MIRT2594566	hsa-miR-3180-5p	CLIP-seq
MIRT2594567	hsa-miR-3185	CLIP-seq
MIRT2594572	hsa-miR-3622a-3p	CLIP-seq
MIRT2594573	hsa-miR-3622b-3p	CLIP-seq
MIRT2069908	hsa-miR-3646	CLIP-seq
MIRT1552328	hsa-miR-3658	CLIP-seq
MIRT1552329	hsa-miR-3670	CLIP-seq
MIRT2594574	hsa-miR-3676	CLIP-seq
MIRT2594575	hsa-miR-3686	CLIP-seq
MIRT2594576	hsa-miR-376a	CLIP-seq
MIRT2594577	hsa-miR-376b	CLIP-seq
MIRT1237789	hsa-miR-409-5p	CLIP-seq
MIRT2594578	hsa-miR-412	CLIP-seq
MIRT2594579	hsa-miR-4266	CLIP-seq
MIRT2594580	hsa-miR-4275	CLIP-seq
MIRT2442465	hsa-miR-4280	CLIP-seq
MIRT1237794	hsa-miR-4324	CLIP-seq
MIRT1237800	hsa-miR-4458	CLIP-seq
MIRT1237806	hsa-miR-4500	CLIP-seq
MIRT1237807	hsa-miR-452	CLIP-seq
MIRT1237808	hsa-miR-4639-5p	CLIP-seq
MIRT2594583	hsa-miR-4643	CLIP-seq
MIRT2594584	hsa-miR-466	CLIP-seq
MIRT2594585	hsa-miR-4668-3p	CLIP-seq
MIRT1237812	hsa-miR-4676-3p	CLIP-seq
MIRT2069919	hsa-miR-4689	CLIP-seq
MIRT2069920	hsa-miR-4699-3p	CLIP-seq
MIRT2069921	hsa-miR-4709-3p	CLIP-seq
MIRT1237818	hsa-miR-4725-5p	CLIP-seq
MIRT2069922	hsa-miR-4735-5p	CLIP-seq
MIRT2594586	hsa-miR-4738-3p	CLIP-seq
MIRT2069923	hsa-miR-4760-3p	CLIP-seq
MIRT2594587	hsa-miR-4762-5p	CLIP-seq
MIRT1552330	hsa-miR-4770	CLIP-seq
MIRT2069925	hsa-miR-4778-3p	CLIP-seq
MIRT2594588	hsa-miR-4778-5p	CLIP-seq
MIRT2069926	hsa-miR-4784	CLIP-seq
MIRT2594589	hsa-miR-4789-3p	CLIP-seq
MIRT2594590	hsa-miR-4790-3p	CLIP-seq
MIRT1237823	hsa-miR-4799-5p	CLIP-seq
MIRT1237824	hsa-miR-504	CLIP-seq
MIRT1237826	hsa-miR-511	CLIP-seq
MIRT1237830	hsa-miR-544b	CLIP-seq
MIRT2594591	hsa-miR-548ac	CLIP-seq
MIRT2069931	hsa-miR-548ae	CLIP-seq
MIRT2069932	hsa-miR-548aj	CLIP-seq
MIRT2069933	hsa-miR-548am	CLIP-seq
MIRT2594592	hsa-miR-548d-3p	CLIP-seq
MIRT2594593	hsa-miR-548g	CLIP-seq
MIRT2594594	hsa-miR-548p	CLIP-seq
MIRT2069935	hsa-miR-548x	CLIP-seq
MIRT2594595	hsa-miR-548z	CLIP-seq
MIRT1552331	hsa-miR-556-5p	CLIP-seq
MIRT2069936	hsa-miR-578	CLIP-seq
MIRT2069937	hsa-miR-579	CLIP-seq
MIRT2069939	hsa-miR-581	CLIP-seq
MIRT1237838	hsa-miR-582-5p	CLIP-seq
MIRT1237839	hsa-miR-584	CLIP-seq
MIRT2594596	hsa-miR-617	CLIP-seq
MIRT1237847	hsa-miR-98	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0003723	Function	RNA binding	HDA	22658674
GO:0004672	Function	Protein kinase activity	IEA
GO:0004672	Function	Protein kinase activity	TAS	7851406
GO:0004674	Function	Protein serine/threonine kinase activity	IBA
GO:0004674	Function	Protein serine/threonine kinase activity	IDA	20188095
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004697	Function	Diacylglycerol-dependent serine/threonine kinase activity	IEA
GO:0004713	Function	Protein tyrosine kinase activity	TAS
GO:0005515	Function	Protein binding	IPI	10026169, 11356191, 15364941, 17110931, 20974804, 26638075, 27104747, 35271311
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IDA	11356191
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IDA	17332740
GO:0005737	Component	Cytoplasm	IEA
GO:0005813	Component	Centrosome	IDA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0005886	Component	Plasma membrane	IDA
GO:0006468	Process	Protein phosphorylation	IDA	17332740
GO:0006468	Process	Protein phosphorylation	TAS	9092545
GO:0006915	Process	Apoptotic process	IEA
GO:0007155	Process	Cell adhesion	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007165	Process	Signal transduction	TAS	7851406
GO:0010631	Process	Epithelial cell migration	IDA	21754995
GO:0010631	Process	Epithelial cell migration	IEA
GO:0016020	Component	Membrane	IEA
GO:0016301	Function	Kinase activity	IDA	15364941
GO:0016301	Function	Kinase activity	IEA
GO:0016604	Component	Nuclear body	IDA
GO:0016740	Function	Transferase activity	IEA
GO:0030027	Component	Lamellipodium	IDA	11356191
GO:0030027	Component	Lamellipodium	IEA
GO:0030030	Process	Cell projection organization	IEA
GO:0030496	Component	Midbody	IDA	17332740
GO:0030496	Component	Midbody	IEA
GO:0031267	Function	Small GTPase binding	IEA
GO:0032154	Component	Cleavage furrow	IDA	17332740
GO:0032154	Component	Cleavage furrow	IEA
GO:0032467	Process	Positive regulation of cytokinesis	IMP	17332740
GO:0032991	Component	Protein-containing complex	IDA	23223530
GO:0035556	Process	Intracellular signal transduction	IBA
GO:0042826	Function	Histone deacetylase binding	IDA	20188095
GO:0042995	Component	Cell projection	IEA
GO:0043296	Component	Apical junction complex	IDA	20974804
GO:0043296	Component	Apical junction complex	IEA
GO:0043297	Process	Apical junction assembly	IEA
GO:0043297	Process	Apical junction assembly	IMP	20974804
GO:0045070	Process	Positive regulation of viral genome replication	IMP	15364941
GO:0045111	Component	Intermediate filament cytoskeleton	IDA
GO:0045296	Function	Cadherin binding	HDA	25468996
GO:0045931	Process	Positive regulation of mitotic cell cycle	IMP	17332740
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	15364941
GO:0051301	Process	Cell division	IEA
GO:0070063	Function	RNA polymerase binding	IPI	15364941
GO:0070161	Component	Anchoring junction	IEA
GO:0097700	Process	Vascular endothelial cell response to laminar fluid shear stress	TAS
GO:0106310	Function	Protein serine kinase activity	IEA
GO:0106310	Function	Protein serine kinase activity	TAS
GO:2000145	Process	Regulation of cell motility	IMP	21754995

Other IDs

• MIM: 602549
• HGNC: 9406
• e!Ensembl: ENSG00000065243

Protein

• UniProt ID: Q16513
• Protein name: Serine/threonine-protein kinase N2 (EC 2.7.11.13) (PKN gamma) (Protein kinase C-like 2) (Protein-kinase C-related kinase 2)
• Protein function: PKC-related serine/threonine-protein kinase and Rho/Rac effector protein that participates in specific signal transduction responses in the cell. Plays a role in the regulation of cell cycle progression, actin cytoskeleton assembly, cell migrati
• PDB: 4CRS, 4RRV, 6CCY, 6GBE
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02185	HR1	49 → 111	Hr1 repeat	Family
  PF02185	HR1	137 → 204	Hr1 repeat	Family
  PF02185	HR1	218 → 285	Hr1 repeat	Family
  PF00069	Pkinase	657 → 916	Protein kinase domain	Domain
  PF00433	Pkinase_C	937 → 979	Protein kinase C terminal domain	Family

• Tissue specificity: TISSUE SPECIFICITY: Ubiquitous. Expressed in numerous tumor cell lines, especially in bladder tumor cells. {ECO:0000269|PubMed:10026169, ECO:0000269|PubMed:21754995}.
• Sequence:

  MASNPERGEILLTELQGDSRSLPFSENVSAVQKLDFSDTMVQQKLDDIKDRIKREIRKEL
  KIKEGAENLRKVTTDKKSLAYVDNILKKSNKKLEELHHKLQELNAHIVVSDPEDITDCPR
  TPDTPNNDPRCSTSNNRLKALQKQLDIELKVKQGAENMIQMYSNGSSKDRKLHGTAQQLL
  QDSKTKIEVIRMQILQAVQTNELAFDNAKPVISPLELRMEELRHHFRIEFAVAEGAKNVM
  KLLGSGKVTDRKALSEAQARFNESSQKLDLLKYSLEQRLNEVPKNHPKSRIIIEELSLVA
  ASPTLSPRQSMISTQNQYSTLSKPAALTGTLEVRLMGCQDILENVPGRSKATSVALPGWS
  PSETRSSFMSRTSKSKSGSSRNLLKTDDLSNDVCAVLKLDNTVVGQTSWKPISNQSWDQK
  FTLELDRSRELEISVYWRDWRSLCAVKFLRLEDFLDNQRHGMCLYLEPQGTLFAEVTFFN
  PVIERRPKLQRQKKIFSKQQGKTFLRAPQMNINIATWGRLVRRAIPTVNHSGTFSPQAPV
  PTTVPVVDVRIPQLAPPASDSTVTKLDFDLEPEPPPAPPRASSLGEIDESSELRVLDIPG
  QDSETVFDIQNDRNSILPKSQSEYKPDTPQSGLEYSGIQELEDRRSQQRFQFNLQDFRCC
  AVLGRGHFGKVLLAEYKNTNEMFAIKALKKGDIVARDEVDSLMCEKRIFETVNSVRHPFL
  VNLFACFQTKEHVCFVMEYAAGGDLMMHIHTDVFSEPRAVFYAACVVLGLQYLHEHKIVY
  RDLKLDNLLLDTEGFVKIADFGLCKEGMGYGDRTSTFCGTPEFLAPEVLTETSYTRAVDW
  WGLGVLIYEMLVGESPFPGDDEEEVFDSIVNDEVRYPRFLSTEAISIMRRLLRRNPERRL
  GASEKDAEDVKKHPFFRLIDWSALMDKKVKPPFIPTIRGREDVSNFDDEFTSEAPILTPP
  REPRILSEEEQEMFRDFDYIADWC

• Sequence length: 984

Pathways

KEGG:

PI3K-Akt signaling pathway
NOD-like receptor signaling pathway
Yersinia infection

Reactome:

RHO GTPases activate PKNs

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
CHRONIC OBSTRUCTIVE PULMONARY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma of prostate	Prostate adenocarcinoma	BEFREE	26296974		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	29335522		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	30737985	Associate	★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	23593175	Associate	★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	GWASCAT_DG	29892015		★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	CTD_human_DG	29892015		★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	30134165		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	22194214, 27175635		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	18559534, 21555521, 29353882, 29987050, 30964173		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	18411304, 19242610, 21555521, 29987050, 30964173, 31759986, 31987914	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal Breast	Ductal carcinoma of breast	Pubtator	21555521	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	39350056	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	36152754	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	23653450	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	19876919		★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	20413688		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	GWASCAT_DG	30940143		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	31828845		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	29487189		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	29368606		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	29368606, 33658394	Associate	★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	31564129		★☆☆☆☆ Found in Text Mining only
Cyst	Cyst	BEFREE	19876919		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	31586040		★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	34190178	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	21084393, 38034011	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	26218748	Associate	★☆☆☆☆ Found in Text Mining only
Gestational trophoblastic disease	Hydatidiform mole	BEFREE	20413688		★☆☆☆☆ Found in Text Mining only
Gestational Trophoblastic Neoplasms	Gestational Trophoblastic Neoplasms	BEFREE	20413688		★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	29480433, 30068946		★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	30068946	Associate	★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	31564129		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	25941073		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	35373434	Associate	★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	15194762		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	31706798		★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Intellectual developmental disorder	Pubtator	20691406	Associate	★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	BEFREE	21555521		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	35440579	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	24576777		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	24621074	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	28707321		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	35440579	Associate	★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	29480433, 30068946		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	18559534, 21555521, 29353882, 29987050, 30964173		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	19876919		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	30930982		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	28875501		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	23921907		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	28707321, 30930982, 31051214		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	29368606		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	15047871		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	22511072, 29987050		★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	27914105	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	22194214		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	35373434	Associate	★☆☆☆☆ Found in Text Mining only
Myopathy	Myopathy	BEFREE	30791960		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	22362252, 28707321, 29362401, 29368606, 30361447		★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 2	Neurofibromatosis	Pubtator	34571875	Associate	★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	31587474		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	19876919		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	25050916, 39350056	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	30930982		★☆☆☆☆ Found in Text Mining only
Papilloma	Papilloma	Pubtator	20131316	Associate	★☆☆☆☆ Found in Text Mining only
Paroxysmal atrial fibrillation	Paroxysmal atrial fibrillation	CTD_human_DG	29892015		★☆☆☆☆ Found in Text Mining only
Pemphigus	Pemphigus	Pubtator	31681304	Associate	★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	28875501		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	15908432		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	15908432, 26296974, 32859632	Associate	★☆☆☆☆ Found in Text Mining only
Resistance to Insulin-Like Growth Factor I	IGF-I RESISTANCE	BEFREE	29353882		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	20691406, 21850710		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	CTD_human_DG	20691406		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	Pubtator	20691406	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	28875501, 29714078		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	29480433		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	23921907, 24621074, 33879018	Associate	★☆☆☆☆ Found in Text Mining only
Toe Syndactyly Telecanthus and Anogenital and Renal Malformations	Toe syndactyly-telecanthus-anogenital and renal malformations syndrome	Pubtator	27104747	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	28515445		★☆☆☆☆ Found in Text Mining only
Tuberous Sclerosis	Tuberous Sclerosis	BEFREE	26412398		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	37694778	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	23052694	Stimulate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	33576457	Associate	★☆☆☆☆ Found in Text Mining only