ARHGAP15 (Rho GTPase activating protein 15)

Gene

• Entrez ID: 55843
• Gene name: Rho GTPase activating protein 15
• Gene symbol: ARHGAP15
• Synonyms (NCBI Gene): BM046
• Chromosome: 2
• Chromosome location: 2q22.2-q22.3
• Summary: RHO GTPases (see ARHA; MIM 165390) regulate diverse biologic processes, and their activity is regulated by RHO GTPase-activating proteins (GAPs), such as ARHGAP15 (Seoh et al., 2003 [PubMed 12650940]).[supplied by OMIM, Mar 2008]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT527122	hsa-miR-548aa	PAR-CLIP	22012620
MIRT527121	hsa-miR-548ap-3p	PAR-CLIP	22012620
MIRT527120	hsa-miR-548t-3p	PAR-CLIP	22012620
MIRT527119	hsa-miR-548as-3p	PAR-CLIP	22012620
MIRT527118	hsa-miR-548at-3p	PAR-CLIP	22012620
MIRT527117	hsa-miR-548ay-3p	PAR-CLIP	22012620
MIRT527116	hsa-miR-548u	PAR-CLIP	22012620
MIRT527115	hsa-miR-7161-5p	PAR-CLIP	22012620
MIRT527114	hsa-miR-6750-3p	PAR-CLIP	22012620
MIRT527113	hsa-miR-8087	PAR-CLIP	22012620
MIRT527112	hsa-miR-4426	PAR-CLIP	22012620
MIRT527111	hsa-miR-4647	PAR-CLIP	22012620
MIRT527110	hsa-miR-4662b	PAR-CLIP	22012620
MIRT527109	hsa-miR-1246	PAR-CLIP	22012620
MIRT527108	hsa-miR-4495	PAR-CLIP	22012620
MIRT527107	hsa-miR-3134	PAR-CLIP	22012620
MIRT527106	hsa-miR-4764-3p	PAR-CLIP	22012620
MIRT498238	hsa-miR-3662	PAR-CLIP	22291592
MIRT498237	hsa-miR-5700	PAR-CLIP	22291592
MIRT498236	hsa-miR-586	PAR-CLIP	22291592
MIRT498235	hsa-miR-4698	PAR-CLIP	22291592
MIRT498234	hsa-miR-6807-5p	PAR-CLIP	22291592
MIRT498233	hsa-miR-33a-5p	PAR-CLIP	22291592
MIRT498232	hsa-miR-33b-5p	PAR-CLIP	22291592
MIRT527122	hsa-miR-548aa	PAR-CLIP	22012620
MIRT527121	hsa-miR-548ap-3p	PAR-CLIP	22012620
MIRT527120	hsa-miR-548t-3p	PAR-CLIP	22012620
MIRT527119	hsa-miR-548as-3p	PAR-CLIP	22012620
MIRT527118	hsa-miR-548at-3p	PAR-CLIP	22012620
MIRT527117	hsa-miR-548ay-3p	PAR-CLIP	22012620
MIRT527116	hsa-miR-548u	PAR-CLIP	22012620
MIRT527115	hsa-miR-7161-5p	PAR-CLIP	22012620
MIRT527114	hsa-miR-6750-3p	PAR-CLIP	22012620
MIRT527113	hsa-miR-8087	PAR-CLIP	22012620
MIRT527112	hsa-miR-4426	PAR-CLIP	22012620
MIRT527111	hsa-miR-4647	PAR-CLIP	22012620
MIRT527110	hsa-miR-4662b	PAR-CLIP	22012620
MIRT527109	hsa-miR-1246	PAR-CLIP	22012620
MIRT527108	hsa-miR-4495	PAR-CLIP	22012620
MIRT527107	hsa-miR-3134	PAR-CLIP	22012620
MIRT527106	hsa-miR-4764-3p	PAR-CLIP	22012620
MIRT498238	hsa-miR-3662	PAR-CLIP	22291592
MIRT498237	hsa-miR-5700	PAR-CLIP	22291592
MIRT498236	hsa-miR-586	PAR-CLIP	22291592
MIRT498235	hsa-miR-4698	PAR-CLIP	22291592
MIRT498234	hsa-miR-6807-5p	PAR-CLIP	22291592
MIRT498233	hsa-miR-33a-5p	PAR-CLIP	22291592
MIRT498232	hsa-miR-33b-5p	PAR-CLIP	22291592

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005096	Function	GTPase activator activity	IBA
GO:0005096	Function	GTPase activator activity	IDA	12650940
GO:0005096	Function	GTPase activator activity	IEA
GO:0005096	Function	GTPase activator activity	TAS
GO:0005515	Function	Protein binding	IPI	28514442, 33961781
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA
GO:0007165	Process	Signal transduction	IEA
GO:0007264	Process	Small GTPase-mediated signal transduction	IBA
GO:0008360	Process	Regulation of cell shape	IDA	12650940
GO:0016020	Component	Membrane	IEA
GO:0051056	Process	Regulation of small GTPase mediated signal transduction	TAS

Other IDs

• MIM: 610578
• HGNC: 21030
• e!Ensembl: ENSG00000075884

Protein

• UniProt ID: Q53QZ3
• Protein name: Rho GTPase-activating protein 15 (ArhGAP15) (Rho-type GTPase-activating protein 15)
• Protein function: GTPase activator for the Rho-type GTPases by converting them to an inactive GDP-bound state. Has activity toward RAC1. Overexpression results in an increase in actin stress fibers and cell contraction.
• PDB: 3BYI
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00169	PH	80 → 189	PH domain	Domain
  PF00620	RhoGAP	295 → 447	RhoGAP domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in lung, liver and lymphoid cells. {ECO:0000269|PubMed:12650940}.
• Sequence:

  MQKSTNSDTSVETLNSTRQGTGAVQMRIKNANSHHDRLSQSKSMILTDVGKVTEPISRHR
  RNHSQHILKDVIPPLEQLMVEKEGYLQKAKIADGGKKLRKNWSTSWIVLSSRRIEFYKES
  KQQALSNMKTGHKPESVDLCGAHIEWAKEKSSRKNVFQITTVSGNEFLLQSDIDFIILDW
  FHAIKNAIDRLPKDSSCPSRNLELFKIQRSSSTELLSHYDSDIKEQKPEHRKSLMFRLHH
  SASDTSDKNRVKSRLKKFITRRPSLKTLQEKGLIKDQIFGSHLHKVCERENSTVPWFVKQ
  CIEAVEKRGLDVDGIYRVSGNLATIQKLRFIVNQEEKLNLDDSQWEDIHVVTGALKMFFR
  ELPEPLFPYSFFEQFVEAIKKQDNNTRIEAVKSLVQKLPPPNRDTMKVLFGHLTKIVAKA
  SKNLMSTQSLGIVFGPTLLRAENETGNMAIHMVYQNQIAELMLSEYSKIFGSEED

• Sequence length: 475

Pathways

Reactome:

Rho GTPase cycle

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANDROGENETIC ALOPECIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANXIETY DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHONDROMALACIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIGESTIVE SYSTEM DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIVERTICULAR DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIVERTICULAR DISEASES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIVERTICULITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GALLSTONES	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOOD DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROTIC DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OCULAR SARCOIDOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERITONITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POST-TRAUMATIC STRESS DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RESPIRATORY SYSTEM DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SMOOTH SURFACE DENTAL CARIES	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUBSTANCE ABUSE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TOOTH AGENESIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VASCULAR BRAIN INJURY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Breast Carcinoma	Breast Carcinoma	BEFREE	29534468		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	29534468	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	31298335		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	29867200		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	GWASCAT_DG	29212778		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Disorder	Major depressive disorder	Pubtator	36982982	Associate	★☆☆☆☆ Found in Text Mining only
Developmental absence of tooth	Anodontia	GWASCAT_DG	29364747		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	GWASDB_DG	17463246		★☆☆☆☆ Found in Text Mining only
Diverticular Bleeding	Diverticular Bleeding	CTD_human_DG	28585551, 30177863		★☆☆☆☆ Found in Text Mining only
Diverticular Diseases	Diverticular Diseases	BEFREE	28585551		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diverticular Diseases	Diverticular Diseases	CTD_human_DG	28585551, 30177863		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diverticular Diseases	Diverticular Diseases	GWASCAT_DG	28585551, 30177863, 30661054		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diverticular Diseases	Diverticular disease	Pubtator	28585551, 37196047	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diverticulitis	Diverticulitis	BEFREE	28585551		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diverticulitis	Diverticulitis	GWASCAT_DG	28585551		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diverticulitis	Diverticulitis	Pubtator	28585551, 37196047	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Eczema	Eczema	GWASCAT_DG	30595370		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	27862679, 29867200		★☆☆☆☆ Found in Text Mining only
Hypodontia	Hypodontia	GWASCAT_DG	29364747		★☆☆☆☆ Found in Text Mining only
Hypodontia Oligodontia with Orofacial Cleft	Hypodontia Oligodontia With Orofacial Cleft	GWASCAT_DG	29364747		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	31298335	Associate	★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	GWASCAT_DG	29942085		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant neoplasm of lung	Lung Cancer	BEFREE	31298335		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	29867200		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	35135212	Associate	★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	GWASCAT_DG	29942085		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	29534468, 29867200		★☆☆☆☆ Found in Text Mining only
Oligodontia	Oligodontia	GWASCAT_DG	29364747		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	29867200		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	GWASCAT_DG	31374203		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	36982982	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Tooth Agenesis, Familial	Tooth Agenesis	GWASCAT_DG	29364747		★☆☆☆☆ Found in Text Mining only
TOOTH AGENESIS, SELECTIVE, 9	Tooth Agenesis	GWASCAT_DG	29364747		★☆☆☆☆ Found in Text Mining only
Tooth Agenesis, Selective, With Orofacial Cleft	Tooth Agenesis	GWASCAT_DG	29364747		★☆☆☆☆ Found in Text Mining only
Tooth development and eruption disorder	Tooth Development And Eruption Disorder	GWASCAT_DG	29364747		★☆☆☆☆ Found in Text Mining only