PRKCI (protein kinase C iota)

Gene

• Entrez ID: 5584
• Gene name: Protein kinase C iota
• Gene symbol: PRKCI
• Synonyms (NCBI Gene): DXS1179E, PKCI, nPKC-iota
• Chromosome: 3
• Chromosome location: 3q26.2
• Summary: This gene encodes a member of the protein kinase C (PKC) family of serine/threonine protein kinases. The PKC family comprises at least eight members, which are differentially expressed and are involved in a wide variety of cellular processes. This protein

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT001515	hsa-miR-155-5p	pSILAC	18668040
MIRT001515	hsa-miR-155-5p	Proteomics;Other	18668040
MIRT048786	hsa-miR-93-5p	CLASH	23622248
MIRT037939	hsa-miR-505-5p	CLASH	23622248
MIRT513231	hsa-miR-3613-3p	PAR-CLIP	23446348
MIRT513231	hsa-miR-3613-3p	PAR-CLIP	27292025
MIRT735580	hsa-miR-545-3p	Luciferase reporter assay, Western blotting, qRT-PCR, ELISA	32104945
MIRT513231	hsa-miR-3613-3p	PAR-CLIP	23446348
MIRT1263282	hsa-miR-10a	CLIP-seq
MIRT1263283	hsa-miR-10b	CLIP-seq
MIRT1263284	hsa-miR-1252	CLIP-seq
MIRT1263285	hsa-miR-1275	CLIP-seq
MIRT1263286	hsa-miR-129-5p	CLIP-seq
MIRT1263287	hsa-miR-138	CLIP-seq
MIRT1263288	hsa-miR-140-3p	CLIP-seq
MIRT1263289	hsa-miR-141	CLIP-seq
MIRT1263290	hsa-miR-142-5p	CLIP-seq
MIRT1263291	hsa-miR-146a	CLIP-seq
MIRT1263292	hsa-miR-146b-5p	CLIP-seq
MIRT1263293	hsa-miR-18a	CLIP-seq
MIRT1263294	hsa-miR-18b	CLIP-seq
MIRT1263295	hsa-miR-199a-3p	CLIP-seq
MIRT1263296	hsa-miR-199b-3p	CLIP-seq
MIRT1263297	hsa-miR-200a	CLIP-seq
MIRT1263298	hsa-miR-2053	CLIP-seq
MIRT1263299	hsa-miR-23a	CLIP-seq
MIRT1263300	hsa-miR-23b	CLIP-seq
MIRT1263301	hsa-miR-23c	CLIP-seq
MIRT1263302	hsa-miR-24	CLIP-seq
MIRT1263303	hsa-miR-28-5p	CLIP-seq
MIRT1263304	hsa-miR-3074-5p	CLIP-seq
MIRT1263305	hsa-miR-3129-3p	CLIP-seq
MIRT1263306	hsa-miR-3129-5p	CLIP-seq
MIRT1263307	hsa-miR-3139	CLIP-seq
MIRT1263308	hsa-miR-3140-5p	CLIP-seq
MIRT1263309	hsa-miR-3153	CLIP-seq
MIRT1263310	hsa-miR-3160-5p	CLIP-seq
MIRT1263311	hsa-miR-3163	CLIP-seq
MIRT1263312	hsa-miR-3200-5p	CLIP-seq
MIRT1263313	hsa-miR-323b-3p	CLIP-seq
MIRT1263314	hsa-miR-345	CLIP-seq
MIRT1263315	hsa-miR-3620	CLIP-seq
MIRT1263316	hsa-miR-365	CLIP-seq
MIRT1263317	hsa-miR-3662	CLIP-seq
MIRT1263318	hsa-miR-3664-3p	CLIP-seq
MIRT1263319	hsa-miR-3686	CLIP-seq
MIRT1263320	hsa-miR-374a	CLIP-seq
MIRT1263321	hsa-miR-374b	CLIP-seq
MIRT1263322	hsa-miR-384	CLIP-seq
MIRT1263323	hsa-miR-3927	CLIP-seq
MIRT1263324	hsa-miR-3938	CLIP-seq
MIRT1263325	hsa-miR-3942-3p	CLIP-seq
MIRT1263326	hsa-miR-4251	CLIP-seq
MIRT1263327	hsa-miR-4256	CLIP-seq
MIRT1263328	hsa-miR-4260	CLIP-seq
MIRT1263329	hsa-miR-4284	CLIP-seq
MIRT1263330	hsa-miR-4317	CLIP-seq
MIRT1263331	hsa-miR-4329	CLIP-seq
MIRT1263332	hsa-miR-4417	CLIP-seq
MIRT1263333	hsa-miR-4418	CLIP-seq
MIRT1263334	hsa-miR-4433	CLIP-seq
MIRT1263335	hsa-miR-4437	CLIP-seq
MIRT1263336	hsa-miR-4456	CLIP-seq
MIRT1263337	hsa-miR-4459	CLIP-seq
MIRT1263338	hsa-miR-4492	CLIP-seq
MIRT1263339	hsa-miR-4494	CLIP-seq
MIRT1263340	hsa-miR-4498	CLIP-seq
MIRT1263341	hsa-miR-450b-5p	CLIP-seq
MIRT1263342	hsa-miR-4521	CLIP-seq
MIRT1263343	hsa-miR-4633-3p	CLIP-seq
MIRT1263344	hsa-miR-4652-3p	CLIP-seq
MIRT1263345	hsa-miR-4662a-3p	CLIP-seq
MIRT1263346	hsa-miR-4665-5p	CLIP-seq
MIRT1263347	hsa-miR-4674	CLIP-seq
MIRT1263348	hsa-miR-4694-3p	CLIP-seq
MIRT1263349	hsa-miR-4698	CLIP-seq
MIRT1263350	hsa-miR-4735-3p	CLIP-seq
MIRT1263351	hsa-miR-4742-3p	CLIP-seq
MIRT1263352	hsa-miR-4747-5p	CLIP-seq
MIRT1263353	hsa-miR-4768-3p	CLIP-seq
MIRT1263354	hsa-miR-4802-3p	CLIP-seq
MIRT1263355	hsa-miR-486-5p	CLIP-seq
MIRT1263356	hsa-miR-491-3p	CLIP-seq
MIRT1263357	hsa-miR-499a-5p	CLIP-seq
MIRT1263358	hsa-miR-501-3p	CLIP-seq
MIRT1263359	hsa-miR-502-3p	CLIP-seq
MIRT1263360	hsa-miR-507	CLIP-seq
MIRT1263361	hsa-miR-509-3-5p	CLIP-seq
MIRT1263362	hsa-miR-509-5p	CLIP-seq
MIRT1263363	hsa-miR-522	CLIP-seq
MIRT1263364	hsa-miR-541	CLIP-seq
MIRT1263365	hsa-miR-548ac	CLIP-seq
MIRT1263366	hsa-miR-548ae	CLIP-seq
MIRT1263367	hsa-miR-548aj	CLIP-seq
MIRT1263368	hsa-miR-548am	CLIP-seq
MIRT1263369	hsa-miR-548d-3p	CLIP-seq
MIRT1263370	hsa-miR-548x	CLIP-seq
MIRT1263371	hsa-miR-548z	CLIP-seq
MIRT1263372	hsa-miR-557	CLIP-seq
MIRT1263373	hsa-miR-561	CLIP-seq
MIRT1263374	hsa-miR-563	CLIP-seq
MIRT1263375	hsa-miR-568	CLIP-seq
MIRT1263376	hsa-miR-569	CLIP-seq
MIRT1263377	hsa-miR-586	CLIP-seq
MIRT1263378	hsa-miR-589	CLIP-seq
MIRT1263379	hsa-miR-630	CLIP-seq
MIRT1263380	hsa-miR-648	CLIP-seq
MIRT1263381	hsa-miR-654-5p	CLIP-seq
MIRT1263382	hsa-miR-656	CLIP-seq
MIRT1263383	hsa-miR-708	CLIP-seq
MIRT1263384	hsa-miR-762	CLIP-seq
MIRT1263385	hsa-miR-889	CLIP-seq
MIRT1263386	hsa-miR-943	CLIP-seq
MIRT1552566	hsa-miR-4775	CLIP-seq
MIRT1552567	hsa-miR-590-3p	CLIP-seq
MIRT2077498	hsa-miR-103a	CLIP-seq
MIRT2077499	hsa-miR-107	CLIP-seq
MIRT2077500	hsa-miR-1231	CLIP-seq
MIRT2077501	hsa-miR-1244	CLIP-seq
MIRT2077502	hsa-miR-1283	CLIP-seq
MIRT1263286	hsa-miR-129-5p	CLIP-seq
MIRT2077503	hsa-miR-1299	CLIP-seq
MIRT2077504	hsa-miR-15a	CLIP-seq
MIRT2077505	hsa-miR-15b	CLIP-seq
MIRT2077506	hsa-miR-16	CLIP-seq
MIRT2077507	hsa-miR-195	CLIP-seq
MIRT2077508	hsa-miR-197	CLIP-seq
MIRT2077509	hsa-miR-1972	CLIP-seq
MIRT2077510	hsa-miR-219-5p	CLIP-seq
MIRT2077511	hsa-miR-224	CLIP-seq
MIRT1263302	hsa-miR-24	CLIP-seq
MIRT2077512	hsa-miR-29a	CLIP-seq
MIRT2077513	hsa-miR-29b	CLIP-seq
MIRT2077514	hsa-miR-29c	CLIP-seq
MIRT2077515	hsa-miR-3065-3p	CLIP-seq
MIRT2077516	hsa-miR-3121-5p	CLIP-seq
MIRT2077517	hsa-miR-3130-3p	CLIP-seq
MIRT1263309	hsa-miR-3153	CLIP-seq
MIRT2077518	hsa-miR-3157-3p	CLIP-seq
MIRT1263310	hsa-miR-3160-5p	CLIP-seq
MIRT2077519	hsa-miR-325	CLIP-seq
MIRT2077520	hsa-miR-3618	CLIP-seq
MIRT1263316	hsa-miR-365	CLIP-seq
MIRT2077521	hsa-miR-3660	CLIP-seq
MIRT1263317	hsa-miR-3662	CLIP-seq
MIRT2077522	hsa-miR-376a	CLIP-seq
MIRT2077523	hsa-miR-376b	CLIP-seq
MIRT2077524	hsa-miR-3922-5p	CLIP-seq
MIRT1263325	hsa-miR-3942-3p	CLIP-seq
MIRT2077525	hsa-miR-424	CLIP-seq
MIRT1263327	hsa-miR-4256	CLIP-seq
MIRT2077526	hsa-miR-4261	CLIP-seq
MIRT2077527	hsa-miR-4263	CLIP-seq
MIRT1263329	hsa-miR-4284	CLIP-seq
MIRT2077528	hsa-miR-4288	CLIP-seq
MIRT1263330	hsa-miR-4317	CLIP-seq
MIRT2077529	hsa-miR-4318	CLIP-seq
MIRT2077530	hsa-miR-4445	CLIP-seq
MIRT1263339	hsa-miR-4494	CLIP-seq
MIRT2077531	hsa-miR-4526	CLIP-seq
MIRT2077532	hsa-miR-4668-5p	CLIP-seq
MIRT2077533	hsa-miR-4708-3p	CLIP-seq
MIRT2077534	hsa-miR-4714-3p	CLIP-seq
MIRT2077535	hsa-miR-4716-5p	CLIP-seq
MIRT2077536	hsa-miR-4719	CLIP-seq
MIRT2077537	hsa-miR-4753-5p	CLIP-seq
MIRT2077538	hsa-miR-4762-3p	CLIP-seq
MIRT2077539	hsa-miR-4766-5p	CLIP-seq
MIRT1552566	hsa-miR-4775	CLIP-seq
MIRT2077540	hsa-miR-4782-3p	CLIP-seq
MIRT1263354	hsa-miR-4802-3p	CLIP-seq
MIRT2077541	hsa-miR-489	CLIP-seq
MIRT2077542	hsa-miR-497	CLIP-seq
MIRT1263357	hsa-miR-499a-5p	CLIP-seq
MIRT2077543	hsa-miR-508-3p	CLIP-seq
MIRT2077544	hsa-miR-5096	CLIP-seq
MIRT2077545	hsa-miR-513a-3p	CLIP-seq
MIRT2077546	hsa-miR-514	CLIP-seq
MIRT2077547	hsa-miR-514b-3p	CLIP-seq
MIRT2077548	hsa-miR-556-3p	CLIP-seq
MIRT1263374	hsa-miR-563	CLIP-seq
MIRT1552567	hsa-miR-590-3p	CLIP-seq
MIRT2077549	hsa-miR-627	CLIP-seq
MIRT2077550	hsa-miR-632	CLIP-seq
MIRT2077551	hsa-miR-671-5p	CLIP-seq
MIRT2077552	hsa-miR-875-3p	CLIP-seq
MIRT2077498	hsa-miR-103a	CLIP-seq
MIRT2077499	hsa-miR-107	CLIP-seq
MIRT2304037	hsa-miR-1208	CLIP-seq
MIRT2304038	hsa-miR-1227	CLIP-seq
MIRT2077500	hsa-miR-1231	CLIP-seq
MIRT2077501	hsa-miR-1244	CLIP-seq
MIRT2077503	hsa-miR-1299	CLIP-seq
MIRT2304039	hsa-miR-1301	CLIP-seq
MIRT2077504	hsa-miR-15a	CLIP-seq
MIRT2077505	hsa-miR-15b	CLIP-seq
MIRT2077506	hsa-miR-16	CLIP-seq
MIRT2077507	hsa-miR-195	CLIP-seq
MIRT2304040	hsa-miR-1976	CLIP-seq
MIRT2304041	hsa-miR-203	CLIP-seq
MIRT2077510	hsa-miR-219-5p	CLIP-seq
MIRT2077511	hsa-miR-224	CLIP-seq
MIRT1263299	hsa-miR-23a	CLIP-seq
MIRT1263300	hsa-miR-23b	CLIP-seq
MIRT1263301	hsa-miR-23c	CLIP-seq
MIRT1263302	hsa-miR-24	CLIP-seq
MIRT2304042	hsa-miR-297	CLIP-seq
MIRT2077512	hsa-miR-29a	CLIP-seq
MIRT2077513	hsa-miR-29b	CLIP-seq
MIRT2077514	hsa-miR-29c	CLIP-seq
MIRT2077515	hsa-miR-3065-3p	CLIP-seq
MIRT2077516	hsa-miR-3121-5p	CLIP-seq
MIRT2304043	hsa-miR-3140-3p	CLIP-seq
MIRT1263308	hsa-miR-3140-5p	CLIP-seq
MIRT2304044	hsa-miR-3143	CLIP-seq
MIRT2304045	hsa-miR-3151	CLIP-seq
MIRT2304046	hsa-miR-3157-5p	CLIP-seq
MIRT1263310	hsa-miR-3160-5p	CLIP-seq
MIRT2304047	hsa-miR-320e	CLIP-seq
MIRT1263313	hsa-miR-323b-3p	CLIP-seq
MIRT2077519	hsa-miR-325	CLIP-seq
MIRT2304048	hsa-miR-3657	CLIP-seq
MIRT2304049	hsa-miR-3659	CLIP-seq
MIRT1263317	hsa-miR-3662	CLIP-seq
MIRT2304050	hsa-miR-3680	CLIP-seq
MIRT2304051	hsa-miR-3713	CLIP-seq
MIRT2077522	hsa-miR-376a	CLIP-seq
MIRT2077523	hsa-miR-376b	CLIP-seq
MIRT1263322	hsa-miR-384	CLIP-seq
MIRT2304052	hsa-miR-3920	CLIP-seq
MIRT2077524	hsa-miR-3922-5p	CLIP-seq
MIRT1263325	hsa-miR-3942-3p	CLIP-seq
MIRT2077525	hsa-miR-424	CLIP-seq
MIRT2077526	hsa-miR-4261	CLIP-seq
MIRT2077527	hsa-miR-4263	CLIP-seq
MIRT2304053	hsa-miR-4279	CLIP-seq
MIRT1263329	hsa-miR-4284	CLIP-seq
MIRT2077528	hsa-miR-4288	CLIP-seq
MIRT1263330	hsa-miR-4317	CLIP-seq
MIRT2077529	hsa-miR-4318	CLIP-seq
MIRT2304054	hsa-miR-4327	CLIP-seq
MIRT2304055	hsa-miR-4423-5p	CLIP-seq
MIRT2077530	hsa-miR-4445	CLIP-seq
MIRT2304056	hsa-miR-4447	CLIP-seq
MIRT2304057	hsa-miR-4450	CLIP-seq
MIRT2304058	hsa-miR-4472	CLIP-seq
MIRT2304059	hsa-miR-448	CLIP-seq
MIRT1263339	hsa-miR-4494	CLIP-seq
MIRT2304060	hsa-miR-4509	CLIP-seq
MIRT2304061	hsa-miR-455-5p	CLIP-seq
MIRT2304062	hsa-miR-4639-3p	CLIP-seq
MIRT2304063	hsa-miR-4645-5p	CLIP-seq
MIRT2304064	hsa-miR-4658	CLIP-seq
MIRT2304065	hsa-miR-4669	CLIP-seq
MIRT2304066	hsa-miR-4673	CLIP-seq
MIRT2304067	hsa-miR-4679	CLIP-seq
MIRT2304068	hsa-miR-4693-5p	CLIP-seq
MIRT1263349	hsa-miR-4698	CLIP-seq
MIRT2304069	hsa-miR-4699-3p	CLIP-seq
MIRT2077533	hsa-miR-4708-3p	CLIP-seq
MIRT2304070	hsa-miR-4715-3p	CLIP-seq
MIRT2077536	hsa-miR-4719	CLIP-seq
MIRT2304071	hsa-miR-4735-5p	CLIP-seq
MIRT2304072	hsa-miR-4740-3p	CLIP-seq
MIRT2077538	hsa-miR-4762-3p	CLIP-seq
MIRT1552566	hsa-miR-4775	CLIP-seq
MIRT2077540	hsa-miR-4782-3p	CLIP-seq
MIRT1263354	hsa-miR-4802-3p	CLIP-seq
MIRT2077541	hsa-miR-489	CLIP-seq
MIRT2304073	hsa-miR-491-5p	CLIP-seq
MIRT2077542	hsa-miR-497	CLIP-seq
MIRT1263357	hsa-miR-499a-5p	CLIP-seq
MIRT1263358	hsa-miR-501-3p	CLIP-seq
MIRT1263359	hsa-miR-502-3p	CLIP-seq
MIRT2304074	hsa-miR-5047	CLIP-seq
MIRT2077543	hsa-miR-508-3p	CLIP-seq
MIRT2304075	hsa-miR-5095	CLIP-seq
MIRT2304076	hsa-miR-515-5p	CLIP-seq
MIRT2304077	hsa-miR-548aa	CLIP-seq
MIRT2304078	hsa-miR-552	CLIP-seq
MIRT2077548	hsa-miR-556-3p	CLIP-seq
MIRT2304079	hsa-miR-567	CLIP-seq
MIRT2304080	hsa-miR-574-5p	CLIP-seq
MIRT1552567	hsa-miR-590-3p	CLIP-seq
MIRT2077550	hsa-miR-632	CLIP-seq
MIRT2304081	hsa-miR-664	CLIP-seq
MIRT2077551	hsa-miR-671-5p	CLIP-seq
MIRT2077552	hsa-miR-875-3p	CLIP-seq
MIRT2304082	hsa-miR-892a	CLIP-seq
MIRT1263285	hsa-miR-1275	CLIP-seq
MIRT1263287	hsa-miR-138	CLIP-seq
MIRT1263328	hsa-miR-4260	CLIP-seq
MIRT1263336	hsa-miR-4456	CLIP-seq
MIRT1263338	hsa-miR-4492	CLIP-seq
MIRT1263340	hsa-miR-4498	CLIP-seq
MIRT1263346	hsa-miR-4665-5p	CLIP-seq
MIRT1263352	hsa-miR-4747-5p	CLIP-seq
MIRT1263364	hsa-miR-541	CLIP-seq
MIRT1263381	hsa-miR-654-5p	CLIP-seq
MIRT1263384	hsa-miR-762	CLIP-seq
MIRT2077511	hsa-miR-224	CLIP-seq
MIRT2077536	hsa-miR-4719	CLIP-seq
MIRT2432276	hsa-miR-515-3p	CLIP-seq
MIRT2432277	hsa-miR-519e	CLIP-seq
MIRT2432278	hsa-miR-579	CLIP-seq
MIRT2457163	hsa-miR-1343	CLIP-seq
MIRT2304040	hsa-miR-1976	CLIP-seq
MIRT2457164	hsa-miR-3149	CLIP-seq
MIRT2457165	hsa-miR-3167	CLIP-seq
MIRT2457166	hsa-miR-411	CLIP-seq
MIRT2304070	hsa-miR-4715-3p	CLIP-seq
MIRT2304071	hsa-miR-4735-5p	CLIP-seq
MIRT1552566	hsa-miR-4775	CLIP-seq
MIRT2457167	hsa-miR-498	CLIP-seq
MIRT1552567	hsa-miR-590-3p	CLIP-seq
MIRT2457168	hsa-miR-876-5p	CLIP-seq
MIRT2304038	hsa-miR-1227	CLIP-seq
MIRT2457164	hsa-miR-3149	CLIP-seq
MIRT2457165	hsa-miR-3167	CLIP-seq
MIRT2457166	hsa-miR-411	CLIP-seq
MIRT2304061	hsa-miR-455-5p	CLIP-seq
MIRT2304070	hsa-miR-4715-3p	CLIP-seq
MIRT2304071	hsa-miR-4735-5p	CLIP-seq
MIRT1552566	hsa-miR-4775	CLIP-seq
MIRT1552567	hsa-miR-590-3p	CLIP-seq
MIRT2457168	hsa-miR-876-5p	CLIP-seq
MIRT2304038	hsa-miR-1227	CLIP-seq
MIRT2601006	hsa-miR-125a-3p	CLIP-seq
MIRT1263285	hsa-miR-1275	CLIP-seq
MIRT1263286	hsa-miR-129-5p	CLIP-seq
MIRT2457163	hsa-miR-1343	CLIP-seq
MIRT1263287	hsa-miR-138	CLIP-seq
MIRT1263290	hsa-miR-142-5p	CLIP-seq
MIRT2304040	hsa-miR-1976	CLIP-seq
MIRT2601007	hsa-miR-200b	CLIP-seq
MIRT2601008	hsa-miR-200c	CLIP-seq
MIRT2304041	hsa-miR-203	CLIP-seq
MIRT2304043	hsa-miR-3140-3p	CLIP-seq
MIRT2304044	hsa-miR-3143	CLIP-seq
MIRT2457164	hsa-miR-3149	CLIP-seq
MIRT2601009	hsa-miR-3616-5p	CLIP-seq
MIRT2601010	hsa-miR-3647-5p	CLIP-seq
MIRT1263317	hsa-miR-3662	CLIP-seq
MIRT1263323	hsa-miR-3927	CLIP-seq
MIRT2601011	hsa-miR-3934	CLIP-seq
MIRT2601012	hsa-miR-3935	CLIP-seq
MIRT2457166	hsa-miR-411	CLIP-seq
MIRT1263327	hsa-miR-4256	CLIP-seq
MIRT1263328	hsa-miR-4260	CLIP-seq
MIRT2077527	hsa-miR-4263	CLIP-seq
MIRT2601013	hsa-miR-429	CLIP-seq
MIRT1263336	hsa-miR-4456	CLIP-seq
MIRT2304059	hsa-miR-448	CLIP-seq
MIRT1263338	hsa-miR-4492	CLIP-seq
MIRT1263340	hsa-miR-4498	CLIP-seq
MIRT2304061	hsa-miR-455-5p	CLIP-seq
MIRT2304063	hsa-miR-4645-5p	CLIP-seq
MIRT1263346	hsa-miR-4665-5p	CLIP-seq
MIRT2304066	hsa-miR-4673	CLIP-seq
MIRT2601014	hsa-miR-4694-5p	CLIP-seq
MIRT1263349	hsa-miR-4698	CLIP-seq
MIRT2304069	hsa-miR-4699-3p	CLIP-seq
MIRT2304070	hsa-miR-4715-3p	CLIP-seq
MIRT2601015	hsa-miR-4724-5p	CLIP-seq
MIRT2304071	hsa-miR-4735-5p	CLIP-seq
MIRT1263352	hsa-miR-4747-5p	CLIP-seq
MIRT1552566	hsa-miR-4775	CLIP-seq
MIRT2601016	hsa-miR-4795-5p	CLIP-seq
MIRT1263356	hsa-miR-491-3p	CLIP-seq
MIRT2457167	hsa-miR-498	CLIP-seq
MIRT1263358	hsa-miR-501-3p	CLIP-seq
MIRT1263359	hsa-miR-502-3p	CLIP-seq
MIRT2304075	hsa-miR-5095	CLIP-seq
MIRT1263364	hsa-miR-541	CLIP-seq
MIRT2304078	hsa-miR-552	CLIP-seq
MIRT1263373	hsa-miR-561	CLIP-seq
MIRT2601017	hsa-miR-573	CLIP-seq
MIRT1552567	hsa-miR-590-3p	CLIP-seq
MIRT1263381	hsa-miR-654-5p	CLIP-seq
MIRT1263384	hsa-miR-762	CLIP-seq
MIRT2601018	hsa-miR-764	CLIP-seq
MIRT2304038	hsa-miR-1227	CLIP-seq
MIRT2457163	hsa-miR-1343	CLIP-seq
MIRT2304040	hsa-miR-1976	CLIP-seq
MIRT2601007	hsa-miR-200b	CLIP-seq
MIRT2601008	hsa-miR-200c	CLIP-seq
MIRT2304043	hsa-miR-3140-3p	CLIP-seq
MIRT2304044	hsa-miR-3143	CLIP-seq
MIRT2457164	hsa-miR-3149	CLIP-seq
MIRT2601009	hsa-miR-3616-5p	CLIP-seq
MIRT2601010	hsa-miR-3647-5p	CLIP-seq
MIRT1263317	hsa-miR-3662	CLIP-seq
MIRT2457166	hsa-miR-411	CLIP-seq
MIRT1263327	hsa-miR-4256	CLIP-seq
MIRT2077527	hsa-miR-4263	CLIP-seq
MIRT2304053	hsa-miR-4279	CLIP-seq
MIRT2601013	hsa-miR-429	CLIP-seq
MIRT2304059	hsa-miR-448	CLIP-seq
MIRT2304061	hsa-miR-455-5p	CLIP-seq
MIRT2304063	hsa-miR-4645-5p	CLIP-seq
MIRT2304066	hsa-miR-4673	CLIP-seq
MIRT1263349	hsa-miR-4698	CLIP-seq
MIRT2304069	hsa-miR-4699-3p	CLIP-seq
MIRT2304070	hsa-miR-4715-3p	CLIP-seq
MIRT2601015	hsa-miR-4724-5p	CLIP-seq
MIRT2304071	hsa-miR-4735-5p	CLIP-seq
MIRT1552566	hsa-miR-4775	CLIP-seq
MIRT2601016	hsa-miR-4795-5p	CLIP-seq
MIRT1263356	hsa-miR-491-3p	CLIP-seq
MIRT2457167	hsa-miR-498	CLIP-seq
MIRT1263358	hsa-miR-501-3p	CLIP-seq
MIRT1263359	hsa-miR-502-3p	CLIP-seq
MIRT2304075	hsa-miR-5095	CLIP-seq
MIRT2304078	hsa-miR-552	CLIP-seq
MIRT2601017	hsa-miR-573	CLIP-seq
MIRT1552567	hsa-miR-590-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	IEA
GO:0000166	Function	Nucleotide binding	IEA
GO:0004672	Function	Protein kinase activity	IDA	11724794
GO:0004672	Function	Protein kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	IBA
GO:0004674	Function	Protein serine/threonine kinase activity	IDA	8226978, 21983565
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004697	Function	Diacylglycerol-dependent serine/threonine kinase activity	EXP	12700136
GO:0004697	Function	Diacylglycerol-dependent serine/threonine kinase activity	IEA
GO:0004697	Function	Diacylglycerol-dependent serine/threonine kinase activity	TAS
GO:0004699	Function	Diacylglycerol-dependent, calcium-independent serine/threonine kinase activity	IEA
GO:0004699	Function	Diacylglycerol-dependent, calcium-independent serine/threonine kinase activity	ISS
GO:0005515	Function	Protein binding	IPI	11257119, 11260256, 11724794, 12725730, 12893243, 14676191, 15590654, 16189514, 16792529, 17057644, 17313651, 17979178, 19617897, 20562859, 20808283, 21516116, 23446420, 24375676, 24525231, 24682284, 25416956, 25852190, 26496610, 26977885, 28514442, 31980649, 32296183, 32707033, 339
GO:0005524	Function	ATP binding	IEA
GO:0005524	Function	ATP binding	TAS	8226978
GO:0005543	Function	Phospholipid binding	IDA	8226978
GO:0005634	Component	Nucleus	IDA	11260256, 21419810
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IEA
GO:0005768	Component	Endosome	IEA
GO:0005829	Component	Cytosol	IDA	11257119, 21419810
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	TAS
GO:0005903	Component	Brush border	IEA
GO:0005923	Component	Bicellular tight junction	IEA
GO:0005929	Component	Cilium	IDA
GO:0005929	Component	Cilium	IEA
GO:0006468	Process	Protein phosphorylation	IDA	8226978
GO:0006612	Process	Protein targeting to membrane	NAS	11257119
GO:0007010	Process	Cytoskeleton organization	NAS	11257119
GO:0007015	Process	Actin filament organization	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0010976	Process	Positive regulation of neuron projection development	IDA	36250347
GO:0010976	Process	Positive regulation of neuron projection development	IDA	36250347
GO:0010976	Process	Positive regulation of neuron projection development	IMP	10467349
GO:0015630	Component	Microtubule cytoskeleton	IDA
GO:0016020	Component	Membrane	IEA
GO:0016192	Process	Vesicle-mediated transport	TAS	11257119
GO:0016301	Function	Kinase activity	IEA
GO:0016324	Component	Apical plasma membrane	IEA
GO:0016477	Process	Cell migration	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0030010	Process	Establishment of cell polarity	IBA
GO:0031252	Component	Cell leading edge	IEA
GO:0032869	Process	Cellular response to insulin stimulus	IBA
GO:0032869	Process	Cellular response to insulin stimulus	IEA
GO:0032869	Process	Cellular response to insulin stimulus	ISS
GO:0034351	Process	Negative regulation of glial cell apoptotic process	IMP	21419810
GO:0035089	Process	Establishment of apical/basal cell polarity	IEA
GO:0035556	Process	Intracellular signal transduction	IBA
GO:0042462	Process	Eye photoreceptor cell development	IEA
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0043066	Process	Negative regulation of apoptotic process	TAS
GO:0043220	Component	Schmidt-Lanterman incisure	IEA
GO:0043434	Process	Response to peptide hormone	IEA
GO:0043524	Process	Negative regulation of neuron apoptotic process	IDA	10467349
GO:0045171	Component	Intercellular bridge	IDA
GO:0045177	Component	Apical part of cell	IEA
GO:0045197	Process	Establishment or maintenance of epithelial cell apical/basal polarity	IDA	11257119
GO:0045197	Process	Establishment or maintenance of epithelial cell apical/basal polarity	ISS
GO:0045197	Process	Establishment or maintenance of epithelial cell apical/basal polarity	TAS	14676191
GO:0045216	Process	Cell-cell junction organization	IMP	11257119
GO:0045747	Process	Positive regulation of Notch signaling pathway	TAS
GO:0046326	Process	Positive regulation of D-glucose import	IEA
GO:0046326	Process	Positive regulation of D-glucose import	ISS
GO:0046872	Function	Metal ion binding	IEA
GO:0046903	Process	Secretion	NAS	8226978
GO:0048194	Process	Golgi vesicle budding	IEA
GO:0051092	Process	Positive regulation of NF-kappaB transcription factor activity	IDA	10467349
GO:0060252	Process	Positive regulation of glial cell proliferation	IMP	21419810
GO:0061024	Process	Membrane organization	NAS	11257119
GO:0062197	Process	Cellular response to chemical stress	TAS
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:0070160	Component	Tight junction	NAS	11257119
GO:0070555	Process	Response to interleukin-1	IEA
GO:0072659	Process	Protein localization to plasma membrane	IBA
GO:0098685	Component	Schaffer collateral - CA1 synapse	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0099072	Process	Regulation of postsynaptic membrane neurotransmitter receptor levels	IEA
GO:0106310	Function	Protein serine kinase activity	IEA
GO:0120157	Component	PAR polarity complex	IPI	11257119
GO:0120157	Component	PAR polarity complex	ISS
GO:1903078	Process	Positive regulation of protein localization to plasma membrane	IEA
GO:1903078	Process	Positive regulation of protein localization to plasma membrane	ISS
GO:2000353	Process	Positive regulation of endothelial cell apoptotic process	IMP	19327373

Other IDs

• MIM: 600539
• HGNC: 9404
• e!Ensembl: ENSG00000163558

Protein

• UniProt ID: P41743
• Protein name: Protein kinase C iota type (EC 2.7.11.13) (Atypical protein kinase C-lambda/iota) (PRKC-lambda/iota) (aPKC-lambda/iota) (nPKC-iota)
• Protein function: Calcium- and diacylglycerol-independent serine/ threonine-protein kinase that plays a general protective role against apoptotic stimuli, is involved in NF-kappa-B activation, cell survival, differentiation and polarity, and contributes to the re
• PDB: 1VD2, 1WMH, 1ZRZ, 3A8W, 3A8X, 3ZH8, 5LI1, 5LI9, 5LIH, 6ILZ, 8R3X, 8R3Y
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00564	PB1	25 → 107	PB1 domain	Domain
  PF00130	C1_1	141 → 193	Phorbol esters/diacylglycerol binding domain (C1 domain)	Domain
  PF00069	Pkinase	254 → 522	Protein kinase domain	Domain
  PF00433	Pkinase_C	544 → 584	Protein kinase C terminal domain	Family

• Tissue specificity: TISSUE SPECIFICITY: Predominantly expressed in lung and brain, but also expressed at lower levels in many tissues including pancreatic islets. Highly expressed in non-small cell lung cancers. {ECO:0000269|PubMed:15994303, ECO:0000269|PubMed:7607695, ECO:0
• Sequence:

  MPTQRDSSTMSHTVAGGGSGDHSHQVRVKAYYRGDIMITHFEPSISFEGLCNEVRDMCSF
  DNEQLFTMKWIDEEGDPCTVSSQLELEEAFRLYELNKDSELLIHVFPCVPERPGMPCPGE
  DKSIYRRGARRWRKLYCANGHTFQAKRFNRRAHCAICTDRIWGLGRQGYKCINCKLLVHK
  KCHKLVTIECGRHSLPQEPVMPMDQSSMHSDHAQTVIPYNPSSHESLDQVGEEKEAMNTR
  ESGKASSSLGLQDFDLLRVIGRGSYAKVLLVRLKKTDRIYAMKVVKKELVNDDEDIDWVQ
  TEKHVFEQASNHPFLVGLHSCFQTESRLFFVIEYVNGGDLMFHMQRQRKLPEEHARFYSA
  EISLALNYLHERGIIYRDLKLDNVLLDSEGHIKLTDYGMCKEGLRPGDTTSTFCGTPNYI
  APEILRGEDYGFSVDWWALGVLMFEMMAGRSPFDIVGSSDNPDQNTEDYLFQVILEKQIR
  IPRSLSVKAASVLKSFLNKDPKERLGCHPQTGFADIQGHPFFRNVDWDMMEQKQVVPPFK
  PNISGEFGLDNFDSQFTNEPVQLTPDDDDIVRKIDQSEFEGFEYINPLLMSAEECV

• Sequence length: 596

Pathways

KEGG:

Rap1 signaling pathway
Endocytosis
Hippo signaling pathway
Tight junction
Platelet activation
Insulin signaling pathway
Human papillomavirus infection

Reactome:

Pre-NOTCH Transcription and Translation
p75NTR recruits signalling complexes
Tight junction interactions

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
AUTISTIC DISORDER	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESTROGEN-RECEPTOR NEGATIVE BREAST CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG ADENOCARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN ENDOMETRIOID CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN SEROUS CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRKCI-related disorder	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL LUNG CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma	Adenocarcinoma	BEFREE	31660987		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	26977885, 31412817		★☆☆☆☆ Found in Text Mining only
Alveolar rhabdomyosarcoma	Alveolar Rhabdomyosarcoma	BEFREE	22349825		★☆☆☆☆ Found in Text Mining only
Anodontia	Anodontia	Pubtator	28844109	Associate	★☆☆☆☆ Found in Text Mining only
Apraxia, Developmental Verbal	Apraxia	BEFREE	30801864		★☆☆☆☆ Found in Text Mining only
Behavioral tic	Tourette syndrome	BEFREE	24174471		★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	19912621, 21382426		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	BEFREE	21382426, 26563126		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinogenesis	Carcinogenesis	Pubtator	27481515, 28844109	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	31086464, 33880589, 37532886	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	24174471		★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	31968252, 32992230	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	24174471, 27321186, 28698296		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	LHGDN	18234642		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	21744423		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	27207650, 28844109, 32686686	Associate	★☆☆☆☆ Found in Text Mining only
Cyst	Cyst	BEFREE	24072773		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	PSYGENET_DG	22485133		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Digestive System Neoplasms	Digestive system neoplasm	Pubtator	31086464	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	21310827, 23359356		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	17990328, 21310827, 23359356		★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	27481515	Associate	★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	BEFREE	25075050		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	LHGDN	18212741		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	21419810, 22120720, 26208522, 27299852		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	21419810, 26208522	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	21419810, 22120720, 26208522, 27299852		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	LHGDN	15695176		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	21419810, 30204596, 31409777		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	21419810, 29946338	Associate	★☆☆☆☆ Found in Text Mining only
Hemangiosarcoma	Hemangiosarcoma	BEFREE	30801864		★☆☆☆☆ Found in Text Mining only
Hemangiosarcoma	Hemangiosarcoma	Pubtator	30801864	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary hemochromatosis	Hereditary Hemochromatosis	BEFREE	27321186		★☆☆☆☆ Found in Text Mining only
Hirschsprung Disease	Hirschsprung Disease	BEFREE	29895226		★☆☆☆☆ Found in Text Mining only
Hirschsprung Disease	Hirschsprung disease	Pubtator	29895226	Inhibit	★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	28070856		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	31086464		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	15705582, 18632643		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	33155212	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	31086464	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	33716239, 34268958	Stimulate	★☆☆☆☆ Found in Text Mining only
Malignant Meningioma	Malignant Meningioma	BEFREE	21419810		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	21310827, 23359356		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	31086464		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	24174471		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	24174471, 27321186, 28698296		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	21373201, 24510606, 26475383		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	31570472, 31773680		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	22120720, 24072773, 29228547, 30204596		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	28844109, 31086464		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	15887250, 18538170		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	24753582		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	12140376		★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	21419810	Associate	★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	PSYGENET_DG	22485133		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Metastatic melanoma	Metastatic Melanoma	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	17990328, 21310827, 21373201, 22349825, 24174471, 27299852, 27321186, 27481515, 29228547, 29551772, 31086464		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	21315177		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	31410027, 31660987		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	16116079		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	24174471, 27321186, 28698296		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	40243672	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Serous Adenocarcinoma	Ovarian serous adenocarcinoma	BEFREE	27321186		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	25915428	Associate	★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	21373201, 24510606, 26475383		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostate carcinoma	Prostate cancer	GWASCAT_DG	25939597		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	21373201, 34268958	Associate	★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	22349825		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	17990328		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	23359356, 31660987		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	17990328, 21310827, 27481515		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	24525231, 27321186		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	31570472, 31773680		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	31086464, 31773680	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	33716239	Associate	★☆☆☆☆ Found in Text Mining only
Tic disorder	Tic Disorder	BEFREE	24174471		★☆☆☆☆ Found in Text Mining only