Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
Entrez ID	55837
Gene name	E2F associated phosphoprotein
Gene symbol	EAPP
Synonyms (NCBI Gene)	BM036C14orf11
Chromosome	14
Chromosome location	14q13.1
Summary	This gene encodes a phosphoprotein that interacts with several members of the E2F family of proteins. The protein localizes to the nucleus, and is present throughout the cell cycle except during mitosis. It functions to modulate E2F-regulated transcriptio

109

Show/Hide all (109)

miRTarBase ID	miRNA	Experiments	Reference
MIRT020078	hsa-miR-361-5p	Sequencing	20371350
MIRT048911	hsa-miR-93-5p	CLASH	23622248
MIRT951217	hsa-miR-101	CLIP-seq
MIRT951218	hsa-miR-1206	CLIP-seq
MIRT951219	hsa-miR-1225-5p	CLIP-seq
MIRT951220	hsa-miR-144	CLIP-seq
MIRT951221	hsa-miR-3152-5p	CLIP-seq
MIRT951222	hsa-miR-3613-3p	CLIP-seq
MIRT951223	hsa-miR-4774-3p	CLIP-seq
MIRT951224	hsa-miR-548a-5p	CLIP-seq
MIRT951225	hsa-miR-548ab	CLIP-seq
MIRT951226	hsa-miR-548ak	CLIP-seq
MIRT951227	hsa-miR-548b-5p	CLIP-seq
MIRT951228	hsa-miR-548c-5p	CLIP-seq
MIRT951229	hsa-miR-548d-5p	CLIP-seq
MIRT951230	hsa-miR-548h	CLIP-seq
MIRT951231	hsa-miR-548i	CLIP-seq
MIRT951232	hsa-miR-548j	CLIP-seq
MIRT951233	hsa-miR-548w	CLIP-seq
MIRT951234	hsa-miR-548y	CLIP-seq
MIRT951235	hsa-miR-555	CLIP-seq
MIRT951236	hsa-miR-559	CLIP-seq
MIRT1981750	hsa-miR-1252	CLIP-seq
MIRT1981751	hsa-miR-139-5p	CLIP-seq
MIRT1981752	hsa-miR-2115	CLIP-seq
MIRT1981753	hsa-miR-3201	CLIP-seq
MIRT1981754	hsa-miR-4420	CLIP-seq
MIRT1981755	hsa-miR-4791	CLIP-seq
MIRT1981756	hsa-miR-4797-5p	CLIP-seq
MIRT1981757	hsa-miR-516a-3p	CLIP-seq
MIRT1981758	hsa-miR-668	CLIP-seq
MIRT951218	hsa-miR-1206	CLIP-seq
MIRT2216630	hsa-miR-141	CLIP-seq
MIRT2216631	hsa-miR-145	CLIP-seq
MIRT2216632	hsa-miR-1910	CLIP-seq
MIRT2216633	hsa-miR-200a	CLIP-seq
MIRT2216634	hsa-miR-3074-3p	CLIP-seq
MIRT2216635	hsa-miR-31	CLIP-seq
MIRT2216636	hsa-miR-3125	CLIP-seq
MIRT951221	hsa-miR-3152-5p	CLIP-seq
MIRT2216637	hsa-miR-3180-5p	CLIP-seq
MIRT1981753	hsa-miR-3201	CLIP-seq
MIRT2216638	hsa-miR-330-3p	CLIP-seq
MIRT2216639	hsa-miR-3916	CLIP-seq
MIRT2216640	hsa-miR-455-3p	CLIP-seq
MIRT2216641	hsa-miR-4742-5p	CLIP-seq
MIRT951223	hsa-miR-4774-3p	CLIP-seq
MIRT1981755	hsa-miR-4791	CLIP-seq
MIRT2216642	hsa-miR-499-3p	CLIP-seq
MIRT2216643	hsa-miR-499a-3p	CLIP-seq
MIRT951224	hsa-miR-548a-5p	CLIP-seq
MIRT951225	hsa-miR-548ab	CLIP-seq
MIRT951226	hsa-miR-548ak	CLIP-seq
MIRT951227	hsa-miR-548b-5p	CLIP-seq
MIRT951228	hsa-miR-548c-5p	CLIP-seq
MIRT951229	hsa-miR-548d-5p	CLIP-seq
MIRT951230	hsa-miR-548h	CLIP-seq
MIRT951231	hsa-miR-548i	CLIP-seq
MIRT951232	hsa-miR-548j	CLIP-seq
MIRT951233	hsa-miR-548w	CLIP-seq
MIRT951234	hsa-miR-548y	CLIP-seq
MIRT951236	hsa-miR-559	CLIP-seq
MIRT1981750	hsa-miR-1252	CLIP-seq
MIRT2216635	hsa-miR-31	CLIP-seq
MIRT2216636	hsa-miR-3125	CLIP-seq
MIRT1981753	hsa-miR-3201	CLIP-seq
MIRT2216639	hsa-miR-3916	CLIP-seq
MIRT1981754	hsa-miR-4420	CLIP-seq
MIRT2216641	hsa-miR-4742-5p	CLIP-seq
MIRT1981755	hsa-miR-4791	CLIP-seq
MIRT951224	hsa-miR-548a-5p	CLIP-seq
MIRT951225	hsa-miR-548ab	CLIP-seq
MIRT951226	hsa-miR-548ak	CLIP-seq
MIRT951227	hsa-miR-548b-5p	CLIP-seq
MIRT951228	hsa-miR-548c-5p	CLIP-seq
MIRT951229	hsa-miR-548d-5p	CLIP-seq
MIRT951230	hsa-miR-548h	CLIP-seq
MIRT951231	hsa-miR-548i	CLIP-seq
MIRT951232	hsa-miR-548j	CLIP-seq
MIRT951233	hsa-miR-548w	CLIP-seq
MIRT951234	hsa-miR-548y	CLIP-seq
MIRT951236	hsa-miR-559	CLIP-seq
MIRT1981758	hsa-miR-668	CLIP-seq
MIRT1981750	hsa-miR-1252	CLIP-seq
MIRT2216630	hsa-miR-141	CLIP-seq
MIRT2216633	hsa-miR-200a	CLIP-seq
MIRT1981752	hsa-miR-2115	CLIP-seq
MIRT2216635	hsa-miR-31	CLIP-seq
MIRT2216636	hsa-miR-3125	CLIP-seq
MIRT1981753	hsa-miR-3201	CLIP-seq
MIRT2216639	hsa-miR-3916	CLIP-seq
MIRT2679647	hsa-miR-4311	CLIP-seq
MIRT1981754	hsa-miR-4420	CLIP-seq
MIRT2216641	hsa-miR-4742-5p	CLIP-seq
MIRT1981755	hsa-miR-4791	CLIP-seq
MIRT1981757	hsa-miR-516a-3p	CLIP-seq
MIRT951224	hsa-miR-548a-5p	CLIP-seq
MIRT951225	hsa-miR-548ab	CLIP-seq
MIRT951226	hsa-miR-548ak	CLIP-seq
MIRT951227	hsa-miR-548b-5p	CLIP-seq
MIRT951228	hsa-miR-548c-5p	CLIP-seq
MIRT951229	hsa-miR-548d-5p	CLIP-seq
MIRT951230	hsa-miR-548h	CLIP-seq
MIRT951231	hsa-miR-548i	CLIP-seq
MIRT951232	hsa-miR-548j	CLIP-seq
MIRT951233	hsa-miR-548w	CLIP-seq
MIRT951234	hsa-miR-548y	CLIP-seq
MIRT951236	hsa-miR-559	CLIP-seq
MIRT1981758	hsa-miR-668	CLIP-seq

Show/Hide all (3)

Transcription factor	Regulation	Reference
EGR1	Activation	18588995
SP1	Activation	18588995
SP3	Repression	18588995

Show/Hide all (10)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	16189514, 28514442, 32296183, 33961781
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	15716352
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IDA	15716352
GO:0016607	Component	Nuclear speck	IDA
GO:0032968	Process	Positive regulation of transcription elongation by RNA polymerase II	IDA	15716352
GO:0034244	Process	Negative regulation of transcription elongation by RNA polymerase II	IDA	15716352

MIM	HGNC	e!Ensembl
609486	19312	ENSG00000129518

Q56P03

Protein name

E2F-associated phosphoprotein (EAPP)

Protein function

May play an important role in the fine-tuning of both major E2F1 activities, the regulation of the cell-cycle and the induction of apoptosis. Promotes S-phase entry, and inhibits p14(ARP) expression.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF10238	Eapp_C	138 → 283	E2F-associated phosphoprotein	Family

Tissue specificity

TISSUE SPECIFICITY: Ubiquitously expressed. Highest levels in heart, placenta, skeletal muscle and pancreas. Lower levels in brain, lung and kidney. In the brain, expressed in all regions with high levels in the cerebellum and cerebral cortex. Expressed i

Sequence

MNRLPDDYDPYAVEEPSDEEPALSSSEDEVDVLLHGTPDQKRKLIRECLTGESESSSEDE
FEKEMEAELNSTMKTMEDKLSSLGTGSSSGNGKVATAPTRYYDDIYFDSDSEDEDRAVQV
TKKKKKKQHKIPTNDELLYDPEKDNRDQAWVDAQRRGYHGLGPQRSRQQQPVPNSDAVLN
CPACMTTLCLDCQRHESYKTQYRAMFVMNCSINKEEVLRYKASENRKKRRVHKKMRSNRE
DAAEKAETDVEEIYHPVMCTECSTEVAVYDKDEVFHFFNVLASHS

Sequence length

285

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (2)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Chromosomal Instability	Chromosomal instability	Pubtator	21572256	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Holoprosencephaly	Holoprosencephaly	BEFREE	15820313		★★★★★ ★☆☆☆☆ Found in Text Mining only

EAPP (E2F associated phosphoprotein)