Gene Gene information from NCBI Gene database.
Entrez ID 55835
Gene name Centrosome assembly and centriole elongation protein
Gene symbol CPAP
Synonyms (NCBI Gene)
BM032CENP-JCENPJLAPLIP1MCPH6SASS4SCKL4Sas-4
Chromosome 13
Chromosome location 13q12.12-q12.13
SNPs SNP information provided by dbSNP.
29
SNP ID Visualize variation Clinical significance Consequence
rs138228629 G>A Pathogenic Stop gained, non coding transcript variant, coding sequence variant
rs143258862 A>C Conflicting-interpretations-of-pathogenicity, uncertain-significance Missense variant, non coding transcript variant, coding sequence variant
rs143260721 A>G Conflicting-interpretations-of-pathogenicity, uncertain-significance Missense variant, non coding transcript variant, coding sequence variant
rs199422202 G>- Pathogenic Coding sequence variant, non coding transcript variant, frameshift variant
rs199422203 ACTG>- Pathogenic Genic downstream transcript variant, intron variant, 3 prime UTR variant, non coding transcript variant, coding sequence variant, frameshift variant
miRNA miRNA information provided by mirtarbase database.
36
miRTarBase ID miRNA Experiments Reference
MIRT000829 hsa-miR-15a-5p Microarray 18362358
MIRT000828 hsa-miR-16-5p Microarray 18362358
MIRT016265 hsa-miR-193b-3p Microarray 20304954
MIRT721865 hsa-miR-6515-3p HITS-CLIP 19536157
MIRT721864 hsa-miR-1236-3p HITS-CLIP 19536157
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
48
GO ID Ontology Definition Evidence Reference
GO:0003713 Function Transcription coactivator activity IDA 12198240
GO:0005515 Function Protein binding IPI 11003675, 16516142, 16713569, 20531387, 20852615, 20936779, 22020124, 22699936, 23511974, 24076405, 25385835, 26638075, 32296183, 35271311
GO:0005737 Component Cytoplasm IDA 12198240, 22020124
GO:0005737 Component Cytoplasm IEA
GO:0005813 Component Centrosome IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
609279 17272 ENSG00000151849
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9HC77
Protein name Centrosomal P4.1-associated protein (Centromere protein J) (CENP-J) (Centrosome assembly and centriole elongation protein) (LAG-3-associated protein) (LYST-interacting protein 1)
Protein function Plays an important role in cell division and centrosome function by participating in centriole duplication (PubMed:17681131, PubMed:20531387). Inhibits microtubule nucleation from the centrosome. Involved in the regulation of slow processive gro
PDB 5EIB , 5ITZ , 7Q1E , 7Q1F , 7Z0F , 7Z0G
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07202 Tcp10_C 1148 1181 T-complex protein 10 C-terminus Repeat
PF07202 Tcp10_C 1221 1253 T-complex protein 10 C-terminus Repeat
PF07202 Tcp10_C 1257 1291 T-complex protein 10 C-terminus Repeat
PF07202 Tcp10_C 1293 1326 T-complex protein 10 C-terminus Repeat
Sequence
MFLMPTSSELNSGQNFLTQWMTNPSRAGVILNRGFPILEADKEKRAAVDISTSFPIKGTH
FSDSFSFINEEDSLLEEQKLESNNPYKPQSDKSETHTAFPCIKKGPQVAACHSAPGHQEE
NKNDFIPDLASEFKEGAYKDPLFKKLEQLKEVQQKKQEQLKRQQLEQLQRLMEEQEKLLT
MVSGQCTLPGLSLLPDDQSQKHRSPGNTTTGERATCCFPSYVYPDPTQEETYPSNILSHE
QSNFCRTAHGDFVLTSKRASPNLFSEAQYQEAPVEKNNLKEENRNHPTGESILCWEKVTE
QIQEANDKNLQKHDDSSEVANIEERPIKAAIGERKQTFEDYLEEQIQLEEQELKQKQLKE
AEGPLPIKAKPKQPFLKRGEGLARFTNAKSKFQKGKESKLVTNQSTSEDQPLFKMDRQQL
QRKTALKNKELCADNPILKKDSKARTKSGSVTLSQKPKMLKCSNRKSLSPSGLKIQTGKK
CDGQFRDQIKFENKVTSNNKENVTECPKPCDTGCTGWNKTQGKDRLPLSTGPASRLAAKS
PIRETMKESESSLDVSLQKKLETWEREKEKENLELDEFLFLEQAADEISFSSNSSFVLKI
LERDQQICKGHRMSSTPVKAVPQKTNPADPISHCNRSEDLDHTAREKESECEVAPKQLHS
LSSADELREQPCKIRKAVQKSTSENQTEWNARDDEGVPNSDSSTDSEEQLDVTIKPSTED
RERGISSREDSPQVCDDKGPFKDTRTQEDKRRDVDLDLSDKDYSSDESIMESIKHKVSEP
SRSSSLSLSKMDFDDERTWTDLEENLCNHDVVLGNESTYGTPQTCYPNNEIGILDKTIKR
KIAPVKRGEDLSKSRRSRSPPTSELMMKFFPSLKPKPKSDSHLGNELKLNISQDQPPGDN
ARSQVLREKIIELETEIEKFKAENASLAKLRIERESALEKLRKEIADFEQQKAKELARIE
EFKKEEMRKLQKERKVFEKYTTAARTFPDKKEREEIQTLKQQIADLREDLKRKETKWSST
HSRLRSQIQMLVRENTDLREEIKVMERFRLDAWKRAEAIESSLEVEKKDKLANTSVRFQN
SQISSGTQVEKYKKNYLPMQGNPPRRSKSAPPRDLGNLDKGQAASPREPLEPLNFPDPEY
KEEEEDQDIQGEISHPDGKVEKVYKNGCRVILFPNGTRKEVSADGKTITVTFFNGDVKQV
MPDQRVIYYYAAAQTTHTTYPEGLEVLHFSSGQIEKHYPDGRKEITFPDQTVKNLFPDGQ
EESIFPDGTIVRVQRDGNKLIEFNNGQRELH
TAQFKRREYPDGTVKTVYANGHQETKYRS
GRIRVK
DKEGNVLMDTEL
Sequence length 1338
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Regulation of PLK1 Activity at G2/M Transition
Loss of Nlp from mitotic centrosomes
Recruitment of mitotic centrosome proteins and complexes
Loss of proteins required for interphase microtubule organization from the centrosome
Recruitment of NuMA to mitotic centrosomes
Anchoring of the basal body to the plasma membrane
TP53 regulates transcription of additional cell cycle genes whose exact role in the p53 pathway remain uncertain
AURKA Activation by TPX2
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
36
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession Evidence Score
Autosomal recessive primary microcephaly Likely pathogenic; Pathogenic rs797045454 RCV000825515
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
CENPJ-related disorder Likely pathogenic rs2541687655 RCV004528002
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Lissencephaly Likely pathogenic; Pathogenic rs199422203 RCV001391259
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Lissencephaly type 3 Pathogenic rs759188041, rs201111299 RCV001004050
RCV001004049
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
Acute myeloid leukemia Likely benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Cervical cancer Conflicting classifications of pathogenicity; Benign; Likely benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma Conflicting classifications of pathogenicity; Benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
CONGENITAL MICROCEPHALY Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Acute Coronary Syndrome Coronary Syndrome BEFREE 24558424
★☆☆☆☆
Found in Text Mining only
Adenocarcinoma of lung (disorder) Lung adenocarcinoma BEFREE 26582240
★☆☆☆☆
Found in Text Mining only
Agenesis of corpus callosum Agenesis Of Corpus Callosum HPO_DG
★☆☆☆☆
Found in Text Mining only
Amnesia Amnesia BEFREE 31595851
★☆☆☆☆
Found in Text Mining only
Anxiety Anxiety Disorder BEFREE 30685849
★☆☆☆☆
Found in Text Mining only
Anxiety Disorders Anxiety Disorder BEFREE 30685849
★☆☆☆☆
Found in Text Mining only
Asthma Asthma Pubtator 33463103 Associate
★☆☆☆☆
Found in Text Mining only
Autosomal Recessive Primary Microcephaly Microcephaly BEFREE 16900296, 24148351, 24385583
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Autosomal Recessive Primary Microcephaly Primary microcephaly Pubtator 19889632, 22699936, 32677750, 35281599, 35404385 Associate
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Autosomal Recessive Primary Microcephaly Microcephaly CLINVAR_DG
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)