Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	55833
Gene name	Ubiquitin associated protein 2
Gene symbol	UBAP2
Synonyms (NCBI Gene)	UBAP-2
Chromosome	9
Chromosome location	9p13.3
Summary	The protein encoded by this gene contains a UBA (ubiquitin associated) domain, which is characteristic of proteins that function in the ubiquitination pathway. This gene may show increased expression in the adrenal gland and lymphatic tissues. Alternative

209

Show/Hide all (209)

miRTarBase ID	miRNA	Experiments	Reference
MIRT003091	hsa-miR-122-5p	Luciferase reporter assayqRT-PCR	19296470
MIRT025365	hsa-miR-34a-5p	Proteomics	21566225
MIRT052395	hsa-let-7a-5p	CLASH	23622248
MIRT051355	hsa-let-7f-5p	CLASH	23622248
MIRT044443	hsa-miR-320a	CLASH	23622248
MIRT610236	hsa-miR-6801-5p	HITS-CLIP	23824327
MIRT610235	hsa-miR-335-3p	HITS-CLIP	23824327
MIRT610236	hsa-miR-6801-5p	HITS-CLIP	23824327
MIRT610235	hsa-miR-335-3p	HITS-CLIP	23824327
MIRT610236	hsa-miR-6801-5p	HITS-CLIP	23824327
MIRT610235	hsa-miR-335-3p	HITS-CLIP	23824327
MIRT610236	hsa-miR-6801-5p	HITS-CLIP	23824327
MIRT610235	hsa-miR-335-3p	HITS-CLIP	23824327
MIRT439368	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT439368	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT737363	hsa-miR-148a-3p	Luciferase reporter assayWestern blottingqRT-PCR	32425115
MIRT610236	hsa-miR-6801-5p	HITS-CLIP	23824327
MIRT610235	hsa-miR-335-3p	HITS-CLIP	23824327
MIRT610236	hsa-miR-6801-5p	HITS-CLIP	23824327
MIRT610235	hsa-miR-335-3p	HITS-CLIP	23824327
MIRT610236	hsa-miR-6801-5p	HITS-CLIP	23824327
MIRT610235	hsa-miR-335-3p	HITS-CLIP	23824327
MIRT610236	hsa-miR-6801-5p	HITS-CLIP	23824327
MIRT610235	hsa-miR-335-3p	HITS-CLIP	23824327
MIRT1466740	hsa-miR-150	CLIP-seq
MIRT1466741	hsa-miR-3064-5p	CLIP-seq
MIRT1466742	hsa-miR-3157-5p	CLIP-seq
MIRT1466743	hsa-miR-3160-3p	CLIP-seq
MIRT1466744	hsa-miR-3187-3p	CLIP-seq
MIRT1466745	hsa-miR-378g	CLIP-seq
MIRT1466746	hsa-miR-4300	CLIP-seq
MIRT1466747	hsa-miR-4427	CLIP-seq
MIRT1466748	hsa-miR-4437	CLIP-seq
MIRT1466749	hsa-miR-4496	CLIP-seq
MIRT1466750	hsa-miR-4529-5p	CLIP-seq
MIRT1466751	hsa-miR-4643	CLIP-seq
MIRT1466752	hsa-miR-4674	CLIP-seq
MIRT1466753	hsa-miR-4676-5p	CLIP-seq
MIRT1466754	hsa-miR-4691-3p	CLIP-seq
MIRT1466755	hsa-miR-4760-5p	CLIP-seq
MIRT1466756	hsa-miR-552	CLIP-seq
MIRT1466757	hsa-miR-575	CLIP-seq
MIRT1466758	hsa-miR-642b	CLIP-seq
MIRT1466759	hsa-miR-892b	CLIP-seq
MIRT1466760	hsa-miR-920	CLIP-seq
MIRT1466761	hsa-miR-939	CLIP-seq
MIRT1466740	hsa-miR-150	CLIP-seq
MIRT2140297	hsa-miR-23a	CLIP-seq
MIRT2140298	hsa-miR-23b	CLIP-seq
MIRT2140299	hsa-miR-23c	CLIP-seq
MIRT1466745	hsa-miR-378g	CLIP-seq
MIRT1466748	hsa-miR-4437	CLIP-seq
MIRT1466749	hsa-miR-4496	CLIP-seq
MIRT1466751	hsa-miR-4643	CLIP-seq
MIRT1466752	hsa-miR-4674	CLIP-seq
MIRT2140300	hsa-miR-520d-5p	CLIP-seq
MIRT2140301	hsa-miR-524-5p	CLIP-seq
MIRT1466758	hsa-miR-642b	CLIP-seq
MIRT1466740	hsa-miR-150	CLIP-seq
MIRT1466745	hsa-miR-378g	CLIP-seq
MIRT2361042	hsa-miR-4286	CLIP-seq
MIRT1466748	hsa-miR-4437	CLIP-seq
MIRT1466749	hsa-miR-4496	CLIP-seq
MIRT1466751	hsa-miR-4643	CLIP-seq
MIRT1466752	hsa-miR-4674	CLIP-seq
MIRT2361043	hsa-miR-4728-5p	CLIP-seq
MIRT2361044	hsa-miR-4771	CLIP-seq
MIRT1466758	hsa-miR-642b	CLIP-seq
MIRT1466749	hsa-miR-4496	CLIP-seq
MIRT1466751	hsa-miR-4643	CLIP-seq
MIRT1466758	hsa-miR-642b	CLIP-seq
MIRT2654723	hsa-miR-1236	CLIP-seq
MIRT2654724	hsa-miR-1270	CLIP-seq
MIRT2654725	hsa-miR-1273e	CLIP-seq
MIRT2654726	hsa-miR-1285	CLIP-seq
MIRT2654727	hsa-miR-139-5p	CLIP-seq
MIRT2654728	hsa-miR-148a	CLIP-seq
MIRT2654729	hsa-miR-148b	CLIP-seq
MIRT1466740	hsa-miR-150	CLIP-seq
MIRT2654730	hsa-miR-152	CLIP-seq
MIRT2654731	hsa-miR-191	CLIP-seq
MIRT2654732	hsa-miR-1976	CLIP-seq
MIRT2654733	hsa-miR-2117	CLIP-seq
MIRT2654734	hsa-miR-221	CLIP-seq
MIRT2654735	hsa-miR-222	CLIP-seq
MIRT2654736	hsa-miR-3136-3p	CLIP-seq
MIRT2654737	hsa-miR-3150a-3p	CLIP-seq
MIRT2654738	hsa-miR-3154	CLIP-seq
MIRT2654739	hsa-miR-3175	CLIP-seq
MIRT2654740	hsa-miR-3179	CLIP-seq
MIRT2654741	hsa-miR-3182	CLIP-seq
MIRT2654742	hsa-miR-3183	CLIP-seq
MIRT2654743	hsa-miR-3185	CLIP-seq
MIRT2654744	hsa-miR-3187-5p	CLIP-seq
MIRT2654745	hsa-miR-3189-5p	CLIP-seq
MIRT2654746	hsa-miR-342-5p	CLIP-seq
MIRT2654747	hsa-miR-34a	CLIP-seq
MIRT2654748	hsa-miR-34c-5p	CLIP-seq
MIRT2654749	hsa-miR-3611	CLIP-seq
MIRT2654750	hsa-miR-3613-3p	CLIP-seq
MIRT2654751	hsa-miR-3616-3p	CLIP-seq
MIRT2654752	hsa-miR-3677-5p	CLIP-seq
MIRT2654753	hsa-miR-3714	CLIP-seq
MIRT2654754	hsa-miR-371-5p	CLIP-seq
MIRT2654755	hsa-miR-371b-5p	CLIP-seq
MIRT1466745	hsa-miR-378g	CLIP-seq
MIRT2654756	hsa-miR-4273	CLIP-seq
MIRT2654757	hsa-miR-432	CLIP-seq
MIRT2654758	hsa-miR-4434	CLIP-seq
MIRT2654759	hsa-miR-4436b-3p	CLIP-seq
MIRT1466748	hsa-miR-4437	CLIP-seq
MIRT2654760	hsa-miR-4447	CLIP-seq
MIRT2654761	hsa-miR-4472	CLIP-seq
MIRT2654762	hsa-miR-4493	CLIP-seq
MIRT1466749	hsa-miR-4496	CLIP-seq
MIRT2654763	hsa-miR-449a	CLIP-seq
MIRT2654764	hsa-miR-449b	CLIP-seq
MIRT2654765	hsa-miR-4516	CLIP-seq
MIRT2654766	hsa-miR-4531	CLIP-seq
MIRT1466751	hsa-miR-4643	CLIP-seq
MIRT2654767	hsa-miR-4651	CLIP-seq
MIRT2654768	hsa-miR-4664-5p	CLIP-seq
MIRT1466752	hsa-miR-4674	CLIP-seq
MIRT2654769	hsa-miR-4683	CLIP-seq
MIRT2654770	hsa-miR-4690-3p	CLIP-seq
MIRT2654771	hsa-miR-4722-3p	CLIP-seq
MIRT2654772	hsa-miR-4723-3p	CLIP-seq
MIRT2361043	hsa-miR-4728-5p	CLIP-seq
MIRT2654773	hsa-miR-4749-3p	CLIP-seq
MIRT2654774	hsa-miR-4758-3p	CLIP-seq
MIRT2654775	hsa-miR-4768-5p	CLIP-seq
MIRT2654776	hsa-miR-4790-3p	CLIP-seq
MIRT2654777	hsa-miR-494	CLIP-seq
MIRT2654778	hsa-miR-513c	CLIP-seq
MIRT2654779	hsa-miR-514b-5p	CLIP-seq
MIRT2654780	hsa-miR-548v	CLIP-seq
MIRT2654781	hsa-miR-549	CLIP-seq
MIRT2654782	hsa-miR-576-3p	CLIP-seq
MIRT2654783	hsa-miR-608	CLIP-seq
MIRT2654784	hsa-miR-612	CLIP-seq
MIRT2654785	hsa-miR-620	CLIP-seq
MIRT1466758	hsa-miR-642b	CLIP-seq
MIRT2654786	hsa-miR-662	CLIP-seq
MIRT2654787	hsa-miR-663b	CLIP-seq
MIRT1466761	hsa-miR-939	CLIP-seq
MIRT2654726	hsa-miR-1285	CLIP-seq
MIRT2694582	hsa-miR-129-3p	CLIP-seq
MIRT2654727	hsa-miR-139-5p	CLIP-seq
MIRT2654728	hsa-miR-148a	CLIP-seq
MIRT2654729	hsa-miR-148b	CLIP-seq
MIRT1466740	hsa-miR-150	CLIP-seq
MIRT2654730	hsa-miR-152	CLIP-seq
MIRT2654731	hsa-miR-191	CLIP-seq
MIRT2654732	hsa-miR-1976	CLIP-seq
MIRT2654733	hsa-miR-2117	CLIP-seq
MIRT2654734	hsa-miR-221	CLIP-seq
MIRT2654735	hsa-miR-222	CLIP-seq
MIRT2654736	hsa-miR-3136-3p	CLIP-seq
MIRT2654737	hsa-miR-3150a-3p	CLIP-seq
MIRT2654738	hsa-miR-3154	CLIP-seq
MIRT2654739	hsa-miR-3175	CLIP-seq
MIRT2654740	hsa-miR-3179	CLIP-seq
MIRT2654743	hsa-miR-3185	CLIP-seq
MIRT2654744	hsa-miR-3187-5p	CLIP-seq
MIRT2654745	hsa-miR-3189-5p	CLIP-seq
MIRT2654746	hsa-miR-342-5p	CLIP-seq
MIRT2654747	hsa-miR-34a	CLIP-seq
MIRT2654748	hsa-miR-34c-5p	CLIP-seq
MIRT2654749	hsa-miR-3611	CLIP-seq
MIRT2654750	hsa-miR-3613-3p	CLIP-seq
MIRT2654751	hsa-miR-3616-3p	CLIP-seq
MIRT2694583	hsa-miR-3661	CLIP-seq
MIRT2654752	hsa-miR-3677-5p	CLIP-seq
MIRT2654753	hsa-miR-3714	CLIP-seq
MIRT2654754	hsa-miR-371-5p	CLIP-seq
MIRT2654755	hsa-miR-371b-5p	CLIP-seq
MIRT1466745	hsa-miR-378g	CLIP-seq
MIRT2654756	hsa-miR-4273	CLIP-seq
MIRT2654758	hsa-miR-4434	CLIP-seq
MIRT2654759	hsa-miR-4436b-3p	CLIP-seq
MIRT1466748	hsa-miR-4437	CLIP-seq
MIRT2654760	hsa-miR-4447	CLIP-seq
MIRT2654761	hsa-miR-4472	CLIP-seq
MIRT2654762	hsa-miR-4493	CLIP-seq
MIRT1466749	hsa-miR-4496	CLIP-seq
MIRT2654763	hsa-miR-449a	CLIP-seq
MIRT2654764	hsa-miR-449b	CLIP-seq
MIRT2654765	hsa-miR-4516	CLIP-seq
MIRT2654766	hsa-miR-4531	CLIP-seq
MIRT1466751	hsa-miR-4643	CLIP-seq
MIRT2654767	hsa-miR-4651	CLIP-seq
MIRT2654768	hsa-miR-4664-5p	CLIP-seq
MIRT1466752	hsa-miR-4674	CLIP-seq
MIRT2654770	hsa-miR-4690-3p	CLIP-seq
MIRT2654771	hsa-miR-4722-3p	CLIP-seq
MIRT2361043	hsa-miR-4728-5p	CLIP-seq
MIRT2654773	hsa-miR-4749-3p	CLIP-seq
MIRT2654774	hsa-miR-4758-3p	CLIP-seq
MIRT2654775	hsa-miR-4768-5p	CLIP-seq
MIRT2654776	hsa-miR-4790-3p	CLIP-seq
MIRT2654778	hsa-miR-513c	CLIP-seq
MIRT2654779	hsa-miR-514b-5p	CLIP-seq
MIRT2654780	hsa-miR-548v	CLIP-seq
MIRT2654783	hsa-miR-608	CLIP-seq
MIRT2654784	hsa-miR-612	CLIP-seq
MIRT2694584	hsa-miR-631	CLIP-seq
MIRT1466758	hsa-miR-642b	CLIP-seq
MIRT2654787	hsa-miR-663b	CLIP-seq
MIRT1466761	hsa-miR-939	CLIP-seq

Show/Hide all (11)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000932	Component	P-body	ISS
GO:0003723	Function	RNA binding	HDA	22658674
GO:0005515	Function	Protein binding	IPI	32296183, 33961781
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005694	Component	Chromosome	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0010468	Process	Regulation of gene expression	ISS
GO:0045296	Function	Cadherin binding	HDA	25468996
GO:0061484	Process	Hematopoietic stem cell homeostasis	IEA

MIM	HGNC	e!Ensembl
HGNC	N/A	HGNC

Q5T6F2

Protein name

Ubiquitin-associated protein 2 (UBAP-2) (RNA polymerase II degradation factor UBAP2)

Protein function

Recruits the ubiquitination machinery to RNA polymerase II for polyubiquitination, removal and degradation, when the transcription-coupled nucleotide excision repair (TC-NER) machinery fails to resolve DNA damage (PubMed:35633597). May promote t

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF12478	DUF3697	512 → 544	Ubiquitin-associated protein 2	Family

Sequence

MMTSVSSDHCRGAREKPQISAAQSTQPQKQVVQATAEQMRLAQVIFDKNDSDFEAKVKQL
MEVTGKNQDECIVALHDCNGDVNKAINILLEGNSDTTSWETVGCKKKNFAKENSENKENR
EKKSEKESSRGRGNNNRKGRGGNRGREFRGEENGIDCNQVDKPSDRGKRARGRGFGRGRG
RGAGRFSTQGMGTFNPADYSDSTSTDVCGTKLVVWEAAQNGADEGTELASNTHNIAQDLS
NKSSYGLKGAWKNSVEEWTTEDWTEDLSETKVFTASSAPAENHILPGQSIDLVALLQKPV
PHSQASEANSFETSQQQGFGQALVFTNSQHNNQMAPGTGSSTAVNSCSPQSLSSVLGSGF
GELAPPKMANITSSQILDQLKAPSLGQFTTTPSTQQNSTSHPTTTTSWDLKPPTSQSSVL
SHLDFKSQPEPSPVLSQLSQRQQHQSQAVTVPPPGLESFPSQAKLRESTPGDSPSTVNKL
LQLPSTTIENISVSVHQPQPKHIKLAKRRIPPASKIPASAVEMPGSADVTGLNVQFGALE
FGSEPSLSEFGSAPSSENSNQIPISLYSKSLSEPLNTSLSMTSAVQNSTYTTSVITSCSL
TSSSLNSASPVAMSSSYDQSSVHNRIPYQSPVSSSESAPGTIMNGHGGGRSQQTLDTPKT
TGPPSALPSVSSLPSTTSCTALLPSTSQHTGDLTSSPLSQLSSSLSSHQSSLSAHAALSS
STSHTHASVESASSHQSSATFSTAATSVSSSASSGASLSSSMNTANSLCLGGTPASASSS
SSRAAPLVTSGKAPPNLPQGVPPLLHNQYLVGPGGLLPAYPIYGYDELQMLQSRLPVDYY
GIPFAAPTALASRDGSLANNPYPGDVTKFGRGDSASPAPATTPAQPQQSQSQTHHTAQQP
FVNPALPPGYSYTGLPYYTGMPSAFQYGPTMFVPPASAKQHGVNLSTPTPPFQQASGYGQ
HGYSTGYDDLTQGTAAGDYSKGGYAGSSQAPNKSAGSGPGKGVSVSSSTTGLPDMTGSVY
NKTQTFDKQGFHAGTPPPFSLPSVLGSTGPLASGAAPGYAPPPFLHILPAHQQPHSQLLH
HHLPQDAQSGSGQRSQPSSLQPKSQASKPAYGNSPYWTN

Sequence length

1119

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (11)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOPOROSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (26)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Anophthalmia with pulmonary hypoplasia	Anophthalmia	Pubtator	32692445	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	31584877	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	27121050	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	32425115	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	31539115		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	31826910, 32767322, 33650644	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	33290408	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	GWASCAT_DG	30054458		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	34608841	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	29805677		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematuria Benign Familial	Hematuria	Pubtator	31539115	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	29805677		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	31539115		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	25069639		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	37848033	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	30314706		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	28977896		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	32472335, 33650644	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	31539115		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	31539115, 33650644	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	31584877, 32692445	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	25069639		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	27074291		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	33290408	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	30314706		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	35263216	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only

UBAP2 (ubiquitin associated protein 2)