SELENOS (selenoprotein S)

Gene

• Entrez ID: 55829
• Gene name: Selenoprotein S
• Gene symbol: SELENOS
• Synonyms (NCBI Gene): AD-015, ADO15, SBBI8, SELS, SEPS1, VIMP
• Chromosome: 15
• Chromosome location: 15q26.3
• Summary: This gene encodes a transmembrane protein that is localized in the endoplasmic reticulum (ER). It is involved in the degradation process of misfolded proteins in the ER, and may also have a role in inflammation control. This protein is a selenoprotein, co

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT525836	hsa-miR-6771-3p	HITS-CLIP	19536157
MIRT525835	hsa-miR-1295b-5p	HITS-CLIP	19536157
MIRT525834	hsa-miR-1912	HITS-CLIP	19536157
MIRT525833	hsa-miR-6769a-3p	HITS-CLIP	19536157
MIRT525832	hsa-miR-551a	HITS-CLIP	19536157
MIRT525831	hsa-miR-551b-3p	HITS-CLIP	19536157
MIRT525827	hsa-miR-1225-3p	HITS-CLIP	19536157
MIRT525825	hsa-miR-4749-3p	HITS-CLIP	19536157
MIRT525830	hsa-miR-6728-3p	HITS-CLIP	21572407
MIRT525829	hsa-miR-93-3p	HITS-CLIP	21572407
MIRT525828	hsa-miR-3692-5p	HITS-CLIP	21572407
MIRT525826	hsa-miR-558	HITS-CLIP	21572407
MIRT525824	hsa-miR-3194-3p	HITS-CLIP	21572407
MIRT525822	hsa-miR-4300	HITS-CLIP	21572407
MIRT525821	hsa-miR-5591-5p	HITS-CLIP	21572407
MIRT525820	hsa-miR-6726-5p	HITS-CLIP	21572407
MIRT525819	hsa-miR-920	HITS-CLIP	21572407
MIRT525818	hsa-miR-6071	HITS-CLIP	21572407
MIRT525817	hsa-miR-448	HITS-CLIP	21572407
MIRT525816	hsa-miR-5691	HITS-CLIP	21572407
MIRT525815	hsa-miR-6805-3p	HITS-CLIP	21572407
MIRT525830	hsa-miR-6728-3p	HITS-CLIP	23313552
MIRT525829	hsa-miR-93-3p	HITS-CLIP	23313552
MIRT525828	hsa-miR-3692-5p	HITS-CLIP	23313552
MIRT525826	hsa-miR-558	HITS-CLIP	23313552
MIRT525824	hsa-miR-3194-3p	HITS-CLIP	23313552
MIRT525823	hsa-miR-184	HITS-CLIP	23313552
MIRT525822	hsa-miR-4300	HITS-CLIP	23313552
MIRT525821	hsa-miR-5591-5p	HITS-CLIP	23313552
MIRT525820	hsa-miR-6726-5p	HITS-CLIP	23313552
MIRT525819	hsa-miR-920	HITS-CLIP	23313552
MIRT525818	hsa-miR-6071	HITS-CLIP	23313552
MIRT525817	hsa-miR-448	HITS-CLIP	23313552
MIRT525816	hsa-miR-5691	HITS-CLIP	23313552
MIRT525815	hsa-miR-6805-3p	HITS-CLIP	23313552
MIRT525814	hsa-miR-4804-5p	HITS-CLIP	23313552
MIRT525830	hsa-miR-6728-3p	HITS-CLIP	24906430
MIRT525829	hsa-miR-93-3p	HITS-CLIP	24906430
MIRT525828	hsa-miR-3692-5p	HITS-CLIP	24906430
MIRT525826	hsa-miR-558	HITS-CLIP	24906430
MIRT525824	hsa-miR-3194-3p	HITS-CLIP	24906430
MIRT525822	hsa-miR-4300	HITS-CLIP	24906430
MIRT525821	hsa-miR-5591-5p	HITS-CLIP	24906430
MIRT525820	hsa-miR-6726-5p	HITS-CLIP	24906430
MIRT525819	hsa-miR-920	HITS-CLIP	24906430
MIRT525818	hsa-miR-6071	HITS-CLIP	24906430
MIRT525817	hsa-miR-448	HITS-CLIP	24906430
MIRT525816	hsa-miR-5691	HITS-CLIP	24906430
MIRT525815	hsa-miR-6805-3p	HITS-CLIP	24906430
MIRT525836	hsa-miR-6771-3p	PAR-CLIP	20371350
MIRT525835	hsa-miR-1295b-5p	PAR-CLIP	20371350
MIRT525834	hsa-miR-1912	PAR-CLIP	20371350
MIRT525833	hsa-miR-6769a-3p	PAR-CLIP	20371350
MIRT525832	hsa-miR-551a	PAR-CLIP	20371350
MIRT525831	hsa-miR-551b-3p	PAR-CLIP	20371350
MIRT525827	hsa-miR-1225-3p	PAR-CLIP	20371350
MIRT525817	hsa-miR-448	PAR-CLIP	20371350
MIRT525830	hsa-miR-6728-3p	PAR-CLIP	20371350
MIRT525829	hsa-miR-93-3p	PAR-CLIP	20371350
MIRT525828	hsa-miR-3692-5p	PAR-CLIP	20371350
MIRT525826	hsa-miR-558	PAR-CLIP	20371350
MIRT525824	hsa-miR-3194-3p	PAR-CLIP	20371350
MIRT525823	hsa-miR-184	PAR-CLIP	20371350
MIRT525822	hsa-miR-4300	PAR-CLIP	20371350
MIRT525821	hsa-miR-5591-5p	PAR-CLIP	20371350
MIRT525820	hsa-miR-6726-5p	PAR-CLIP	20371350
MIRT525819	hsa-miR-920	PAR-CLIP	20371350
MIRT525818	hsa-miR-6071	PAR-CLIP	20371350
MIRT525817	hsa-miR-448	PAR-CLIP	20371350
MIRT525816	hsa-miR-5691	PAR-CLIP	20371350
MIRT525815	hsa-miR-6805-3p	PAR-CLIP	20371350
MIRT525814	hsa-miR-4804-5p	PAR-CLIP	20371350
MIRT525836	hsa-miR-6771-3p	PAR-CLIP	22012620
MIRT525835	hsa-miR-1295b-5p	PAR-CLIP	22012620
MIRT525834	hsa-miR-1912	PAR-CLIP	22012620
MIRT525833	hsa-miR-6769a-3p	PAR-CLIP	22012620
MIRT525832	hsa-miR-551a	PAR-CLIP	22012620
MIRT525831	hsa-miR-551b-3p	PAR-CLIP	22012620
MIRT525830	hsa-miR-6728-3p	PAR-CLIP	22012620
MIRT525829	hsa-miR-93-3p	PAR-CLIP	22012620
MIRT525828	hsa-miR-3692-5p	PAR-CLIP	22012620
MIRT525827	hsa-miR-1225-3p	PAR-CLIP	22012620
MIRT525826	hsa-miR-558	PAR-CLIP	22012620
MIRT525825	hsa-miR-4749-3p	PAR-CLIP	22012620
MIRT525824	hsa-miR-3194-3p	PAR-CLIP	22012620
MIRT525823	hsa-miR-184	PAR-CLIP	22012620
MIRT525822	hsa-miR-4300	PAR-CLIP	22012620
MIRT525821	hsa-miR-5591-5p	PAR-CLIP	22012620
MIRT525820	hsa-miR-6726-5p	PAR-CLIP	22012620
MIRT525819	hsa-miR-920	PAR-CLIP	22012620
MIRT525818	hsa-miR-6071	PAR-CLIP	22012620
MIRT525817	hsa-miR-448	PAR-CLIP	22012620
MIRT525816	hsa-miR-5691	PAR-CLIP	22012620
MIRT525815	hsa-miR-6805-3p	PAR-CLIP	22012620
MIRT525814	hsa-miR-4804-5p	PAR-CLIP	22012620

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002865	Process	Negative regulation of acute inflammatory response to antigenic stimulus	IMP	18675776
GO:0005515	Function	Protein binding	IPI	15215856, 32296183, 32353859, 33060197, 36217030
GO:0005737	Component	Cytoplasm	IEA
GO:0005783	Component	Endoplasmic reticulum	IDA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005783	Component	Endoplasmic reticulum	TAS	16186510
GO:0005789	Component	Endoplasmic reticulum membrane	IDA	15215856
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0005881	Component	Cytoplasmic microtubule	IDA	23264731
GO:0005886	Component	Plasma membrane	TAS	12663463
GO:0006111	Process	Regulation of gluconeogenesis	TAS	12663463
GO:0006886	Process	Intracellular protein transport	IEA
GO:0006983	Process	ER overload response	IDA	16574427
GO:0006983	Process	ER overload response	IMP	17210132
GO:0009749	Process	Response to glucose	IEP	12031974, 15063746
GO:0016020	Component	Membrane	IEA
GO:0016209	Function	Antioxidant activity	IDA	15063746
GO:0019899	Function	Enzyme binding	IPI	15215856
GO:0030968	Process	Endoplasmic reticulum unfolded protein response	IBA
GO:0030968	Process	Endoplasmic reticulum unfolded protein response	IDA	15215856
GO:0030970	Process	Retrograde protein transport, ER to cytosol	IBA
GO:0030970	Process	Retrograde protein transport, ER to cytosol	IDA	15215856
GO:0032715	Process	Negative regulation of interleukin-6 production	IEA
GO:0032715	Process	Negative regulation of interleukin-6 production	ISS
GO:0032720	Process	Negative regulation of tumor necrosis factor production	IEA
GO:0032720	Process	Negative regulation of tumor necrosis factor production	ISS
GO:0032869	Process	Cellular response to insulin stimulus	TAS	12663463
GO:0034361	Component	Very-low-density lipoprotein particle	IDA	17374524
GO:0034362	Component	Low-density lipoprotein particle	IDA	17374524
GO:0034599	Process	Cellular response to oxidative stress	IMP	18675776
GO:0036502	Component	Derlin-1-VIMP complex	IBA
GO:0036502	Component	Derlin-1-VIMP complex	IDA	15215856
GO:0036503	Process	ERAD pathway	IDA	15215856
GO:0036513	Component	Derlin-1 retrotranslocation complex	IBA
GO:0036513	Component	Derlin-1 retrotranslocation complex	IDA	15215856
GO:0038023	Function	Signaling receptor activity	NAS	15215856
GO:0045184	Process	Establishment of protein localization	TAS	15215856
GO:0045454	Process	Cell redox homeostasis	IDA	15063746
GO:0045719	Process	Negative regulation of glycogen biosynthetic process	TAS	12663463
GO:0046325	Process	Negative regulation of D-glucose import	TAS	12663463
GO:0050728	Process	Negative regulation of inflammatory response	IC	16574427
GO:0051117	Function	ATPase binding	IPI	24424410
GO:0051775	Process	Response to redox state	IDA	15063746
GO:0071222	Process	Cellular response to lipopolysaccharide	IMP	18675776
GO:0080164	Process	Regulation of nitric oxide metabolic process	IMP	18675776
GO:0098869	Process	Cellular oxidant detoxification	IEA
GO:1902236	Process	Negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway	IMP	17210132
GO:1990381	Function	Ubiquitin-specific protease binding	IPI	17000876
GO:2000110	Process	Negative regulation of macrophage apoptotic process	IMP	17210132

Other IDs

• MIM: 607918
• HGNC: 30396
• e!Ensembl: ENSG00000131871

Protein

• UniProt ID: Q9BQE4
• Protein name: Selenoprotein S (SelS) (VCP-interacting membrane protein)
• Protein function: Involved in the degradation process of misfolded endoplasmic reticulum (ER) luminal proteins. Participates in the transfer of misfolded proteins from the ER to the cytosol, where they are destroyed by the proteasome in a ubiquitin-dependent mann
• PDB: 2Q2F, 5KIU, 5KIY, 6DO4
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF06936	Selenoprotein_S	1 → 187	Selenoprotein S (SelS)	Family

• Sequence:

  MERQEESLSARPALETEGLRFLHTTVGSLLATYGWYIVFSCILLYVVFQKLSARLRALRQ
  RQLDRAAAAVEPDVVVKRQEALAAARLKMQEELNAQVEKHKEKLKQLEEEKRRQKIEMWD
  SMQEGKSYKGNAKKPQEEDSPGPSTSSVLKRKSDRKPLRGGGYNPLSGEGGGACSWRPGR
  RGPSSGGUG

• Sequence length: 189

Pathways

KEGG:

Protein processing in endoplasmic reticulum

Reactome:

E3 ubiquitin ligases ubiquitinate target proteins

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Acute myeloid leukemia	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Adrenocortical carcinoma, hereditary	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, NON-SMALL-CELL LUNG	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IMMUNE SYSTEM DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Aggressive Periodontitis	Aggressive Periodontitis	BEFREE	21593780		★☆☆☆☆ Found in Text Mining only
alpha 1-Antitrypsin Deficiency	Alpha 1-Antitrypsin Deficiency	BEFREE	23478569		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	27802219	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	30188935	Associate	★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	18710632, 28009916		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	22069270		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	22069270	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	18710632, 28009916		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	LHGDN	18710632		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	30188935, 35795669	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	24278290		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	24278290	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	26708178	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	12031974, 20619427, 23161441, 29721770, 31542866		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	20619427, 23161441, 30889154	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Hemorrhage	Cerebral hemorrhage	Pubtator	40004116	Stimulate	★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	18974842	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	40004116	Stimulate	★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	17880573		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	LHGDN	17880573		★☆☆☆☆ Found in Text Mining only
Cerebrovascular Disorders	Cerebrovascular Disorders	BEFREE	17880573		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	17661913		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	20378690, 22294765		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	22615972, 35807897, 38049731	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	17641917		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	17641917		★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	17641917		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	19036615		★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	22069270	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	22069270		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	15161744, 23829426, 28797256, 30413610		★☆☆☆☆ Found in Text Mining only
Diabetes Complications	Diabetes complications	Pubtator	35806251	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	15161744, 23829426, 28797256, 30413610		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	30413610	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	22069270	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	20619427, 23161441, 30413610, 31265177	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	18625033		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	12031974, 18710632, 20619427, 23161441, 30413610, 31265177		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	LHGDN	18710632		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	31265177	Associate	★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	22069270		★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto Disease	BEFREE	24471570, 26016409, 28290237		★☆☆☆☆ Found in Text Mining only
Ileitis	Ileitis	BEFREE	17661913		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	17661913		★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	20619427, 35806251	Associate	★☆☆☆☆ Found in Text Mining only
insulinoma	Insulinoma	BEFREE	30537728		★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	17641917, 18974842, 25390504		★☆☆☆☆ Found in Text Mining only
Kashin-Beck Disease	Kashin-Beck Disease	BEFREE	25433273		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	17374524		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	24278290		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	17013881		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	19144102		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	26382012, 27524292		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	20619427		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	31542866		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	28315680		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	27802219	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	27802219		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	20471133		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	CTD_human_DG	20471133		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	20619427, 30400605		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	20619427	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	34075060	Associate	★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Disease	Peripheral arterial disease	Pubtator	30188935	Associate	★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Peripheral nervous system disease	Pubtator	30188935	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	17013881		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	18728048		★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	29540208		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	19144102		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	19144102	Associate	★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	40004116	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Diseases	Thyroid Diseases	BEFREE	28499373		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	17661913		★☆☆☆☆ Found in Text Mining only