ALLC (allantoicase)

Gene

• Entrez ID: 55821
• Gene name: Allantoicase
• Gene symbol: ALLC
• Synonyms (NCBI Gene): ALC
• Chromosome: 2
• Chromosome location: 2p25.3
• Summary: Allantoicase (EC 3.5.3.4) participates in the uric acid degradation pathway. Its enzymatic activity, like that of urate oxidase (MIM 191540), was lost during vertebrate evolution.[supplied by OMIM, Nov 2008]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT2170692	hsa-miR-1226	CLIP-seq
MIRT2170693	hsa-miR-3934	CLIP-seq
MIRT2170694	hsa-miR-4477a	CLIP-seq
MIRT2170695	hsa-miR-4733-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000256	Process	Allantoin catabolic process	IEA
GO:0004037	Function	Allantoicase activity	IEA

Other IDs

• MIM: 612396
• HGNC: 17377
• e!Ensembl: ENSG00000151360

Protein

• UniProt ID: Q8N6M5
• Protein name: Probable inactive allantoicase (Allantoate amidinohydrolase)
• Protein function: The function of this enzyme is unclear as allantoicase activity is not known to exist in mammals.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF03561	Allantoicase	9 → 181	Allantoicase repeat	Family
  PF03561	Allantoicase	204 → 365	Allantoicase repeat	Family

• Sequence:

  MDMASESVGGKILFATDDFFAPAENLIKSDSPCFKEHEYTEFGKWMDGWETRRKRIPGHD
  WCVLRLGIQGVIRGFDVDVSYFTGDYAPRVSIQAANLEEDKLPEIPERGTRTGAAATPEE
  FEAIAELKSDDWSYLVPMTELKPGNPASGHNYFLVNSQQRWTHIRLNIFPDGGIARLRVF
  GTGQKDWTATDPKEPADLVAIAFGGVCVGFSNAKFGHPNNIIGVGGAKSMADGWETARRL
  DRPPILENDENGILLVPGCEWAVFRLAHPGVITRIEIDTKYFEGNAPDSCKVDGCILTTQ
  EEEAVIRQKWILPAHKWKPLLPVTKLSPNQSHLFDSLTLELQDVITHARLTIVPDGGVSR
  LRLRGFPSSICLLRPREKPMLKFSVSFKANP

• Sequence length: 391

Pathways

KEGG:

Purine metabolism
Metabolic pathways

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
DENTAL CARIES	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC NEPHROPATHY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Angioimmunoblastic Lymphadenopathy	Angioimmunoblastic T-cell lymphoma	BEFREE	8518181		★☆☆☆☆ Found in Text Mining only
Antisocial Personality Disorder	Antisocial Personality Disorder	BEFREE	17007976, 19302089, 21070510		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	20477771		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	20477771		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	24792382		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	GWASCAT_DG	24792382		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	19015397		★☆☆☆☆ Found in Text Mining only
Dental Caries	Dental caries	Pubtator	29931343	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Fibrosis, Liver	Liver Fibrosis	BEFREE	29849130		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	2538681, 2546633, 8386709		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	28464878		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	25429378		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	2546633, 8386709		★☆☆☆☆ Found in Text Mining only
Lymphopenia	Lymphopenia	BEFREE	30935587		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	12698199		★☆☆☆☆ Found in Text Mining only
Mixed anxiety and depressive disorder	Mixed Anxiety And Depressive Disorder	BEFREE	15084894, 19519719		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	18566379		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	25429378		★☆☆☆☆ Found in Text Mining only