KDM3A (lysine demethylase 3A)

Gene

• Entrez ID: 55818
• Gene name: Lysine demethylase 3A
• Gene symbol: KDM3A
• Synonyms (NCBI Gene): JHDM2A, JHMD2A, JMJD1, JMJD1A, TSGA
• Chromosome: 2
• Chromosome location: 2p11.2
• Summary: This gene encodes a zinc finger protein that contains a jumonji domain and may play a role in hormone-dependent transcriptional activation. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2009]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT006439	hsa-miR-155-5p	In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot	21541331
MIRT006439	hsa-miR-155-5p	In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot	21541331
MIRT006439	hsa-miR-155-5p	In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot	21541331
MIRT006439	hsa-miR-155-5p	In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot	21541331
MIRT006439	hsa-miR-155-5p	In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot	21541331
MIRT006439	hsa-miR-155-5p	In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot	21541331
MIRT006439	hsa-miR-155-5p	In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot	21541331
MIRT006439	hsa-miR-155-5p	In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot	21541331
MIRT006439	hsa-miR-155-5p	In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot	21541331
MIRT006439	hsa-miR-155-5p	In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot	21541331
MIRT006439	hsa-miR-155-5p	Immunohistochemistry, In situ hybridization, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	21541331
MIRT006439	hsa-miR-155-5p	Immunohistochemistry, In situ hybridization, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	21541331
MIRT006439	hsa-miR-155-5p	Immunohistochemistry, In situ hybridization, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	21541331
MIRT006439	hsa-miR-155-5p	In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot	21541331
MIRT006439	hsa-miR-155-5p	In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot	21541331
MIRT006439	hsa-miR-155-5p	In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot	21541331
MIRT006439	hsa-miR-155-5p	In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot	21541331
MIRT006439	hsa-miR-155-5p	In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot	21541331
MIRT006439	hsa-miR-155-5p	Immunohistochemistry, In situ hybridization, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	21541331
MIRT006439	hsa-miR-155-5p	Immunohistochemistry, In situ hybridization, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	21541331
MIRT006439	hsa-miR-155-5p	Immunohistochemistry, In situ hybridization, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	21541331
MIRT040574	hsa-miR-92b-3p	CLASH	23622248
MIRT437860	hsa-miR-627-5p	GFP reporter assay, Western blot	23619147
MIRT437860	hsa-miR-627-5p	GFP reporter assay, Western blot	23619147
MIRT727399	hsa-miR-30a-5p	HITS-CLIP	22473208
MIRT727398	hsa-miR-30b-5p	HITS-CLIP	22473208
MIRT727396	hsa-miR-30c-5p	HITS-CLIP	22473208
MIRT727397	hsa-miR-30d-5p	HITS-CLIP	22473208
MIRT727395	hsa-miR-30e-5p	HITS-CLIP	22473208
MIRT732931	hsa-miR-335-3p	Immunohistochemistry (IHC), Immunoprecipitaion (IP), Luciferase reporter assay, qRT-PCR, Western blotting	33888871
MIRT733599	hsa-miR-22-3p	Luciferase reporter assay, qRT-PCR, Western blotting	31755219
MIRT733599	hsa-miR-22-3p	Luciferase reporter assay, Immunoprecipitaion (IP), qRT-PCR	31755219
MIRT1084338	hsa-let-7a	CLIP-seq
MIRT1084339	hsa-let-7b	CLIP-seq
MIRT1084340	hsa-let-7c	CLIP-seq
MIRT1084341	hsa-let-7d	CLIP-seq
MIRT1084342	hsa-let-7e	CLIP-seq
MIRT1084343	hsa-let-7f	CLIP-seq
MIRT1084344	hsa-let-7g	CLIP-seq
MIRT1084345	hsa-let-7i	CLIP-seq
MIRT1084346	hsa-miR-1253	CLIP-seq
MIRT1084347	hsa-miR-128	CLIP-seq
MIRT1084348	hsa-miR-155	CLIP-seq
MIRT1084349	hsa-miR-202	CLIP-seq
MIRT1084350	hsa-miR-216a	CLIP-seq
MIRT1084351	hsa-miR-224	CLIP-seq
MIRT1084352	hsa-miR-27a	CLIP-seq
MIRT1084353	hsa-miR-27b	CLIP-seq
MIRT1084354	hsa-miR-30a	CLIP-seq
MIRT1084355	hsa-miR-30b	CLIP-seq
MIRT1084356	hsa-miR-30c	CLIP-seq
MIRT1084357	hsa-miR-30d	CLIP-seq
MIRT1084358	hsa-miR-30e	CLIP-seq
MIRT1084359	hsa-miR-3120-5p	CLIP-seq
MIRT1084360	hsa-miR-3121-3p	CLIP-seq
MIRT1084361	hsa-miR-3607-3p	CLIP-seq
MIRT1084362	hsa-miR-3686	CLIP-seq
MIRT1084363	hsa-miR-371-5p	CLIP-seq
MIRT1084364	hsa-miR-371b-5p	CLIP-seq
MIRT1084365	hsa-miR-4458	CLIP-seq
MIRT1084366	hsa-miR-4477b	CLIP-seq
MIRT1084367	hsa-miR-4500	CLIP-seq
MIRT1084368	hsa-miR-4643	CLIP-seq
MIRT1084369	hsa-miR-466	CLIP-seq
MIRT1084370	hsa-miR-4693-5p	CLIP-seq
MIRT1084371	hsa-miR-4698	CLIP-seq
MIRT1084372	hsa-miR-4699-3p	CLIP-seq
MIRT1084373	hsa-miR-4704-5p	CLIP-seq
MIRT1084374	hsa-miR-4720-3p	CLIP-seq
MIRT1084375	hsa-miR-4789-3p	CLIP-seq
MIRT1084376	hsa-miR-4789-5p	CLIP-seq
MIRT1084377	hsa-miR-4804-3p	CLIP-seq
MIRT1084378	hsa-miR-98	CLIP-seq
MIRT1084361	hsa-miR-3607-3p	CLIP-seq
MIRT2021410	hsa-miR-3944-5p	CLIP-seq
MIRT2021411	hsa-miR-4760-3p	CLIP-seq
MIRT2021412	hsa-miR-579	CLIP-seq
MIRT2021413	hsa-miR-664	CLIP-seq
MIRT1084338	hsa-let-7a	CLIP-seq
MIRT1084339	hsa-let-7b	CLIP-seq
MIRT1084340	hsa-let-7c	CLIP-seq
MIRT1084341	hsa-let-7d	CLIP-seq
MIRT1084342	hsa-let-7e	CLIP-seq
MIRT1084343	hsa-let-7f	CLIP-seq
MIRT1084344	hsa-let-7g	CLIP-seq
MIRT1084345	hsa-let-7i	CLIP-seq
MIRT1084346	hsa-miR-1253	CLIP-seq
MIRT1084347	hsa-miR-128	CLIP-seq
MIRT2252865	hsa-miR-1911	CLIP-seq
MIRT1084349	hsa-miR-202	CLIP-seq
MIRT1084350	hsa-miR-216a	CLIP-seq
MIRT2252866	hsa-miR-22	CLIP-seq
MIRT1084351	hsa-miR-224	CLIP-seq
MIRT1084352	hsa-miR-27a	CLIP-seq
MIRT1084353	hsa-miR-27b	CLIP-seq
MIRT1084354	hsa-miR-30a	CLIP-seq
MIRT1084355	hsa-miR-30b	CLIP-seq
MIRT1084356	hsa-miR-30c	CLIP-seq
MIRT1084357	hsa-miR-30d	CLIP-seq
MIRT1084358	hsa-miR-30e	CLIP-seq
MIRT1084359	hsa-miR-3120-5p	CLIP-seq
MIRT1084360	hsa-miR-3121-3p	CLIP-seq
MIRT2252867	hsa-miR-3130-3p	CLIP-seq
MIRT2252868	hsa-miR-3185	CLIP-seq
MIRT2252869	hsa-miR-323-3p	CLIP-seq
MIRT1084361	hsa-miR-3607-3p	CLIP-seq
MIRT1084362	hsa-miR-3686	CLIP-seq
MIRT1084363	hsa-miR-371-5p	CLIP-seq
MIRT1084364	hsa-miR-371b-5p	CLIP-seq
MIRT2252870	hsa-miR-382	CLIP-seq
MIRT2021410	hsa-miR-3944-5p	CLIP-seq
MIRT2252871	hsa-miR-3973	CLIP-seq
MIRT2252872	hsa-miR-410	CLIP-seq
MIRT2252873	hsa-miR-4259	CLIP-seq
MIRT2252874	hsa-miR-4457	CLIP-seq
MIRT1084365	hsa-miR-4458	CLIP-seq
MIRT1084366	hsa-miR-4477b	CLIP-seq
MIRT1084367	hsa-miR-4500	CLIP-seq
MIRT1084368	hsa-miR-4643	CLIP-seq
MIRT1084369	hsa-miR-466	CLIP-seq
MIRT1084370	hsa-miR-4693-5p	CLIP-seq
MIRT1084372	hsa-miR-4699-3p	CLIP-seq
MIRT1084373	hsa-miR-4704-5p	CLIP-seq
MIRT2252875	hsa-miR-4709-3p	CLIP-seq
MIRT2252876	hsa-miR-4722-3p	CLIP-seq
MIRT2021411	hsa-miR-4760-3p	CLIP-seq
MIRT1084375	hsa-miR-4789-3p	CLIP-seq
MIRT1084376	hsa-miR-4789-5p	CLIP-seq
MIRT2252877	hsa-miR-4793-3p	CLIP-seq
MIRT2252878	hsa-miR-4797-5p	CLIP-seq
MIRT2252879	hsa-miR-513b	CLIP-seq
MIRT2252880	hsa-miR-520g	CLIP-seq
MIRT2252881	hsa-miR-520h	CLIP-seq
MIRT2252882	hsa-miR-544	CLIP-seq
MIRT2252883	hsa-miR-548n	CLIP-seq
MIRT2252884	hsa-miR-548t	CLIP-seq
MIRT2021412	hsa-miR-579	CLIP-seq
MIRT2021413	hsa-miR-664	CLIP-seq
MIRT1084378	hsa-miR-98	CLIP-seq
MIRT1084350	hsa-miR-216a	CLIP-seq
MIRT2252873	hsa-miR-4259	CLIP-seq
MIRT2252874	hsa-miR-4457	CLIP-seq
MIRT2252879	hsa-miR-513b	CLIP-seq
MIRT1084346	hsa-miR-1253	CLIP-seq
MIRT1084347	hsa-miR-128	CLIP-seq
MIRT1084351	hsa-miR-224	CLIP-seq
MIRT1084352	hsa-miR-27a	CLIP-seq
MIRT1084353	hsa-miR-27b	CLIP-seq
MIRT1084354	hsa-miR-30a	CLIP-seq
MIRT1084355	hsa-miR-30b	CLIP-seq
MIRT1084356	hsa-miR-30c	CLIP-seq
MIRT1084357	hsa-miR-30d	CLIP-seq
MIRT1084358	hsa-miR-30e	CLIP-seq
MIRT1084359	hsa-miR-3120-5p	CLIP-seq
MIRT1084360	hsa-miR-3121-3p	CLIP-seq
MIRT2252867	hsa-miR-3130-3p	CLIP-seq
MIRT2555904	hsa-miR-3140-3p	CLIP-seq
MIRT1084361	hsa-miR-3607-3p	CLIP-seq
MIRT1084362	hsa-miR-3686	CLIP-seq
MIRT1084366	hsa-miR-4477b	CLIP-seq
MIRT2555905	hsa-miR-4490	CLIP-seq
MIRT1084368	hsa-miR-4643	CLIP-seq
MIRT1084369	hsa-miR-466	CLIP-seq
MIRT1084370	hsa-miR-4693-5p	CLIP-seq
MIRT1084372	hsa-miR-4699-3p	CLIP-seq
MIRT1084373	hsa-miR-4704-5p	CLIP-seq
MIRT1084375	hsa-miR-4789-3p	CLIP-seq
MIRT1084376	hsa-miR-4789-5p	CLIP-seq
MIRT2252877	hsa-miR-4793-3p	CLIP-seq
MIRT2252882	hsa-miR-544	CLIP-seq
MIRT2252883	hsa-miR-548n	CLIP-seq
MIRT2252884	hsa-miR-548t	CLIP-seq
MIRT1084346	hsa-miR-1253	CLIP-seq
MIRT1084347	hsa-miR-128	CLIP-seq
MIRT1084351	hsa-miR-224	CLIP-seq
MIRT1084352	hsa-miR-27a	CLIP-seq
MIRT1084353	hsa-miR-27b	CLIP-seq
MIRT1084354	hsa-miR-30a	CLIP-seq
MIRT1084355	hsa-miR-30b	CLIP-seq
MIRT1084356	hsa-miR-30c	CLIP-seq
MIRT1084357	hsa-miR-30d	CLIP-seq
MIRT1084358	hsa-miR-30e	CLIP-seq
MIRT1084359	hsa-miR-3120-5p	CLIP-seq
MIRT1084360	hsa-miR-3121-3p	CLIP-seq
MIRT2252867	hsa-miR-3130-3p	CLIP-seq
MIRT2555904	hsa-miR-3140-3p	CLIP-seq
MIRT1084361	hsa-miR-3607-3p	CLIP-seq
MIRT1084362	hsa-miR-3686	CLIP-seq
MIRT1084366	hsa-miR-4477b	CLIP-seq
MIRT2555905	hsa-miR-4490	CLIP-seq
MIRT1084368	hsa-miR-4643	CLIP-seq
MIRT1084369	hsa-miR-466	CLIP-seq
MIRT1084370	hsa-miR-4693-5p	CLIP-seq
MIRT1084372	hsa-miR-4699-3p	CLIP-seq
MIRT1084375	hsa-miR-4789-3p	CLIP-seq
MIRT1084376	hsa-miR-4789-5p	CLIP-seq
MIRT2252877	hsa-miR-4793-3p	CLIP-seq
MIRT2252882	hsa-miR-544	CLIP-seq
MIRT2252883	hsa-miR-548n	CLIP-seq
MIRT2252884	hsa-miR-548t	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000118	Component	Histone deacetylase complex	IBA
GO:0000785	Component	Chromatin	IBA
GO:0001673	Component	Male germ cell nucleus	IEA
GO:0003682	Function	Chromatin binding	IEA
GO:0003712	Function	Transcription coregulator activity	IBA
GO:0003712	Function	Transcription coregulator activity	IEA
GO:0005506	Function	Iron ion binding	IMP	16603237
GO:0005515	Function	Protein binding	IPI	25535969, 37179361
GO:0005634	Component	Nucleus	IDA	16603237
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IEA
GO:0006325	Process	Chromatin organization	IEA
GO:0006338	Process	Chromatin remodeling	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0007283	Process	Spermatogenesis	IEA
GO:0007283	Process	Spermatogenesis	IEA
GO:0007290	Process	Spermatid nucleus elongation	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0009755	Process	Hormone-mediated signaling pathway	IDA	16603237
GO:0010468	Process	Regulation of gene expression	IEA
GO:0016020	Component	Membrane	HDA	19946888
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0030521	Process	Androgen receptor signaling pathway	IDA	16603237
GO:0031490	Function	Chromatin DNA binding	IBA
GO:0032454	Function	Histone H3K9 demethylase activity	IBA
GO:0032454	Function	Histone H3K9 demethylase activity	IEA
GO:0032454	Function	Histone H3K9 demethylase activity	IMP	28262558
GO:0045893	Process	Positive regulation of DNA-templated transcription	IMP	16603237
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0046293	Process	Formaldehyde biosynthetic process	IDA	16603237
GO:0046872	Function	Metal ion binding	IEA
GO:0050681	Function	Nuclear androgen receptor binding	IDA	16603237
GO:0051213	Function	Dioxygenase activity	IEA
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	IEA
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	ISS	19194461
GO:0140683	Function	Histone H3K9me/H3K9me2 demethylase activity	IDA	16603237
GO:0140683	Function	Histone H3K9me/H3K9me2 demethylase activity	IEA
GO:1990830	Process	Cellular response to leukemia inhibitory factor	IEA
GO:2000036	Process	Regulation of stem cell population maintenance	IEA
GO:2000736	Process	Regulation of stem cell differentiation	IEA

Other IDs

• MIM: 611512
• HGNC: 20815
• e!Ensembl: ENSG00000115548

Protein

• UniProt ID: Q9Y4C1
• Protein name: Lysine-specific demethylase 3A (EC 1.14.11.65) (JmjC domain-containing histone demethylation protein 2A) (Jumonji domain-containing protein 1A) ([histone H3]-dimethyl-L-lysine(9) demethylase 3A)
• Protein function: Histone demethylase that specifically demethylates 'Lys-9' of histone H3, thereby playing a central role in histone code. Preferentially demethylates mono- and dimethylated H3 'Lys-9' residue, with a preference for dimethylated residue, while it
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02373	JmjC	1151 → 1264	JmjC domain, hydroxylase	Domain

• Sequence:

  MVLTLGESWPVLVGRRFLSLSAADGSDGSHDSWDVERVAEWPWLSGTIRAVSHTDVTKKD
  LKVCVEFDGESWRKRRWIEVYSLLRRAFLVEHNLVLAERKSPEISERIVQWPAITYKPLL
  DKAGLGSITSVRFLGDQQRVFLSKDLLKPIQDVNSLRLSLTDNQIVSKEFQALIVKHLDE
  SHLLKGDKNLVGSEVKIYSLDPSTQWFSATVINGNPASKTLQVNCEEIPALKIVDPSLIH
  VEVVHDNLVTCGNSARIGAVKRKSSENNGTLVSKQAKSCSEASPSMCPVQSVPTTVFKEI
  LLGCTAATPPSKDPRQQSTPQAANSPPNLGAKIPQGCHKQSLPEEISSCLNTKSEALRTK
  PDVCKAGLLSKSSQIGTGDLKILTEPKGSCTQPKTNTDQENRLESVPQALTGLPKECLPT
  KASSKAELEIANPPELQKHLEHAPSPSDVSNAPEVKAGVNSDSPNNCSGKKVEPSALACR
  SQNLKESSVKVDNESCCSRSNNKIQNAPSRKSVLTDPAKLKKLQQSGEAFVQDDSCVNIV
  AQLPKCRECRLDSLRKDKEQQKDSPVFCRFFHFRRLQFNKHGVLRVEGFLTPNKYDNEAI
  GLWLPLTKNVVGIDLDTAKYILANIGDHFCQMVISEKEAMSTIEPHRQVAWKRAVKGVRE
  MCDVCDTTIFNLHWVCPRCGFGVCVDCYRMKRKNCQQGAAYKTFSWLKCVKSQIHEPENL
  MPTQIIPGKALYDVGDIVHSVRAKWGIKANCPCSNRQFKLFSKPASKEDLKQTSLAGEKP
  TLGAVLQQNPSVLEPAAVGGEAASKPAGSMKPACPASTSPLNWLADLTSGNVNKENKEKQ
  PTMPILKNEIKCLPPLPPLSKSSTVLHTFNSTILTPVSNNNSGFLRNLLNSSTGKTENGL
  KNTPKILDDIFASLVQNKTTSDLSKRPQGLTIKPSILGFDTPHYWLCDNRLLCLQDPNNK
  SNWNVFRECWKQGQPVMVSGVHHKLNSELWKPESFRKEFGEQEVDLVNCRTNEIITGATV
  GDFWDGFEDVPNRLKNEKEPMVLKLKDWPPGEDFRDMMPSRFDDLMANIPLPEYTRRDGK
  LNLASRLPNYFVRPDLGPKMYNAYGLITPEDRKYGTTNLHLDVSDAANVMVYVGIPKGQC
  EQEEEVLKTIQDGDSDELTIKRFIEGKEKPGALWHIYAAKDTEKIREFLKKVSEEQGQEN
  PADHDPIHDQSWYLDRSLRKRLHQEYGVQGWAIVQFLGDVVFIPAGAPHQVHNLYSCIKV
  AEDFVSPEHVKHCFWLTQEFRYLSQTHTNHEDKLQVKNVIYHAVKDAVAMLKASESSFGK
  P

• Sequence length: 1321

Pathways

KEGG:

Thermogenesis

Reactome:

HDMs demethylate histones
NR1H3 & NR1H2 regulate gene expression linked to cholesterol transport and efflux

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ATRIAL FIBRILLATION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FLUTTER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KDM3A-related disorder	Benign; Likely benign; Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostate cancer	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUBSTANCE ABUSE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	28521455		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of prostate	Prostate adenocarcinoma	BEFREE	21037926		★☆☆☆☆ Found in Text Mining only
ALPHA-THALASSEMIA/MENTAL RETARDATION SYNDROME, NONDELETION TYPE, X-LINKED	alpha-Thalassemia Mental Retardation Syndrome, X-Linked	BEFREE	30405805		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	31442435		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	27694900		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	25488809, 27034728, 27270439, 29928349, 30578902, 31390833		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	25488809, 38165573	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	26617828, 26728187, 33174020	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	33888871	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	22020899		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	36008383	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	28263974		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	22020899		★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	33888871	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	27694900, 28925393		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	31513837		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	27835890, 30578902		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	27835890, 30578902		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	19858293, 31054974		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	37650153	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	20823141, 29802196, 30405805, 30578902, 30649550		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	30649550, 32457453, 33174020	Associate	★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	21275466, 29928349		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	28135625		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	28135625		★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	28135625		★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Development Disorder	BEFREE	30569092		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	28135625, 29286083		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	28135625, 29286083		★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	33318475	Associate	★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	24362521, 28319067, 29928349, 30578902		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	25609425		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	34479471	Associate	★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	29286083		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	18984585, 24002598, 28416760, 34479471, 37650153	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	29444873, 33318475	Stimulate	★☆☆☆☆ Found in Text Mining only
Infertility	Infertility	Pubtator	30053768	Associate	★☆☆☆☆ Found in Text Mining only
Infertility Male	Male infertility	Pubtator	30053768, 34235877	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	18984585	Stimulate	★☆☆☆☆ Found in Text Mining only
Left Ventricular Hypertrophy	Left Ventricular Hypertrophy	BEFREE	30531796		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	21607773, 23583388		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	28692045		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	34044859	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	27835890, 29590186	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	34171978	Stimulate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	25488809, 27034728, 27270439, 29928349, 30578902, 31390833		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	21275466, 22318714		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	22020899		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	27694900, 28925393		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	31442435		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	20127736, 26279298, 29712835, 29928349, 31321444		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	26617828		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	28263974		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	21275466, 21422728, 22020899, 22037463, 22318714, 23583388, 26617828, 27488962, 28319067, 28416760, 31442435		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	27835890, 30578902		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	31054974		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	29674659		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	26728187, 29444873		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	26728187, 29444873	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	31513837, 31755219		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	21541331		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	21541331	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	19858293, 23619147, 24362521, 25071150, 29156681, 31442435		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	24742640, 30578902		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	24742640	Associate	★☆☆☆☆ Found in Text Mining only
Non-obstructive azoospermia	Non-obstructive azoospermia	BEFREE	27027467, 29105403		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	28135625		★☆☆☆☆ Found in Text Mining only
Oropharyngeal Neoplasms	Oropharyngeal neoplasm	Pubtator	29590186	Associate	★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	27694900, 28925393		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	31442435		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	31442435		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	31442435		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	24002598, 32779232, 34171978	Associate	★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	20127736, 26279298, 29712835, 29928349, 31321444		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	25189356, 26279298, 28416760	Associate	★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	21275466, 22318714		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	21275466, 29928349		★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	Pubtator	32697014	Associate	★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	BEFREE	25071150		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	29590186	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of oropharynx	Oropharyngeal carcinoma	BEFREE	29590186		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	26617828		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	26617828	Stimulate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	32762126	Inhibit	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	34779768, 38165573	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	27835890	Stimulate	★☆☆☆☆ Found in Text Mining only
Vascular System Injuries	Vascular system injury	Pubtator	34479471	Associate	★☆☆☆☆ Found in Text Mining only
Young Syndrome	Young syndrome	Pubtator	27027467	Associate	★☆☆☆☆ Found in Text Mining only