Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	55808
Gene name	ST6 N-acetylgalactosaminide alpha-2,6-sialyltransferase 1
Gene symbol	ST6GALNAC1
Synonyms (NCBI Gene)	HSY11339SIAT7AST6GalNAcISTYI
Chromosome	17
Chromosome location	17q25.1
Summary	Glycosylation of proteins affects cell-cell interaction, interactions with the matrix, and the functions of intracellular molecules. ST6GALNAC1 transfers a sialic acid, N-acetylneuraminic acid (NeuAc), in an alpha-2,6 linkage to O-linked GalNAc residues.

Show/Hide all (36)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016766	hsa-miR-335-5p	Microarray	18185580
MIRT650930	hsa-miR-605-5p	HITS-CLIP	23824327
MIRT650929	hsa-miR-3155a	HITS-CLIP	23824327
MIRT650928	hsa-miR-3155b	HITS-CLIP	23824327
MIRT650927	hsa-miR-484	HITS-CLIP	23824327
MIRT650926	hsa-miR-4645-5p	HITS-CLIP	23824327
MIRT650925	hsa-miR-4673	HITS-CLIP	23824327
MIRT650924	hsa-miR-3607-3p	HITS-CLIP	23824327
MIRT650923	hsa-miR-3686	HITS-CLIP	23824327
MIRT650922	hsa-miR-4743-3p	HITS-CLIP	23824327
MIRT650921	hsa-miR-4652-3p	HITS-CLIP	23824327
MIRT650930	hsa-miR-605-5p	HITS-CLIP	23824327
MIRT650929	hsa-miR-3155a	HITS-CLIP	23824327
MIRT650928	hsa-miR-3155b	HITS-CLIP	23824327
MIRT650927	hsa-miR-484	HITS-CLIP	23824327
MIRT650926	hsa-miR-4645-5p	HITS-CLIP	23824327
MIRT650925	hsa-miR-4673	HITS-CLIP	23824327
MIRT650924	hsa-miR-3607-3p	HITS-CLIP	23824327
MIRT650923	hsa-miR-3686	HITS-CLIP	23824327
MIRT650922	hsa-miR-4743-3p	HITS-CLIP	23824327
MIRT650921	hsa-miR-4652-3p	HITS-CLIP	23824327
MIRT1393725	hsa-miR-3655	CLIP-seq
MIRT1393726	hsa-miR-4275	CLIP-seq
MIRT1393727	hsa-miR-4659a-5p	CLIP-seq
MIRT1393728	hsa-miR-4659b-5p	CLIP-seq
MIRT1393729	hsa-miR-4662a-5p	CLIP-seq
MIRT1393730	hsa-miR-4776-3p	CLIP-seq
MIRT1393731	hsa-miR-526b	CLIP-seq
MIRT1393732	hsa-miR-924	CLIP-seq
MIRT2634067	hsa-miR-4764-3p	CLIP-seq
MIRT2634068	hsa-miR-4777-5p	CLIP-seq
MIRT2634069	hsa-miR-518d-5p	CLIP-seq
MIRT2634070	hsa-miR-519b-5p	CLIP-seq
MIRT2634071	hsa-miR-519c-5p	CLIP-seq
MIRT2634072	hsa-miR-520c-5p	CLIP-seq
MIRT2634073	hsa-miR-526a	CLIP-seq

Show/Hide all (22)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	IDA	16319059, 35303419
GO:0000139	Component	Golgi membrane	IEA
GO:0000139	Component	Golgi membrane	TAS
GO:0001665	Function	Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase activity	IBA
GO:0001665	Function	Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase activity	IDA	16319059, 35303419
GO:0001665	Function	Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase activity	IEA
GO:0001665	Function	Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase activity	TAS
GO:0005515	Function	Protein binding	IPI	28514442, 33961781, 35156780
GO:0005794	Component	Golgi apparatus	IEA
GO:0006486	Process	Protein glycosylation	IDA	16319059
GO:0006486	Process	Protein glycosylation	IEA
GO:0006486	Process	Protein glycosylation	NAS	10536037
GO:0008373	Function	Sialyltransferase activity	IEA
GO:0008373	Function	Sialyltransferase activity	NAS	10536037
GO:0009312	Process	Oligosaccharide biosynthetic process	IBA
GO:0009312	Process	Oligosaccharide biosynthetic process	IEA
GO:0016020	Component	Membrane	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0016757	Function	Glycosyltransferase activity	IEA
GO:0048874	Process	Host-mediated modulation of intestinal microbiota composition	IEA
GO:0048874	Process	Host-mediated modulation of intestinal microbiota composition	ISS
GO:0051851	Process	Host-mediated perturbation of symbiont process	IEA

MIM	HGNC	e!Ensembl
610138	23614	ENSG00000070526

Q9NSC7

Protein name

Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 1 (EC 2.4.3.3) (GalNAc alpha-2,6-sialyltransferase I) (ST6GalNAc I) (ST6GalNAc-I) (ST6GalNAcI) (hST6GalNAc-I) (Sialyltransferase 7A) (SIAT7-A)

Protein function

Protein sialyltransferase specifically expressed in goblet cells that plays a key role in intestinal host-commensal homeostasis (PubMed:35303419). Conjugates sialic acid with an alpha-2-6 linkage to N-acetylgalactosamine (GalNAc) glycan chains l

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00777	Glyco_transf_29	302 → 589	Glycosyltransferase family 29 (sialyltransferase)	Family

Tissue specificity

TISSUE SPECIFICITY: Expression is restricted to the gastrointestinal tract (PubMed:16319059). Highly expressed in goblet cells (PubMed:35303419). Also expressed in various tumor cells (PubMed:16319059). {ECO:0000269|PubMed:16319059, ECO:0000269|PubMed:353

Sequence

MRSCLWRCRHLSQGVQWSLLLAVLVFFLFALPSFIKEPQTKPSRHQRTENIKERSLQSLA
KPKSQAPTRARRTTIYAEPVPENNALNTQTQPKAHTTGDRGKEANQAPPEEQDKVPHTAQ
RAAWKSPEKEKTMVNTLSPRGQDAGMASGRTEAQSWKSQDTKTTQGNGGQTRKLTASRTV
SEKHQGKAATTAKTLIPKSQHRMLAPTGAVSTRTRQKGVTTAVIPPKEKKPQATPPPAPF
QSPTTQRNQRLKAANFKSEPRWDFEEKYSFEIGGLQTTCPDSVKIKASKSLWLQKLFLPN
LTLFLDSRHFNQSEWDRLEHFAPPFGFMELNYSLVQKVVTRFPPVPQQQLLLASLPAGSL
RCITCAVVGNGGILNNSHMGQEIDSHDYVFRLSGALIKGYEQDVGTRTSFYGFTAFSLTQ
SLLILGNRGFKNVPLGKDVRYLHFLEGTRDYEWLEALLMNQTVMSKNLFWFRHRPQEAFR
EALHMDRYLLLHPDFLRYMKNRFLRSKTLDGAHWRIYRPTTGALLLLTALQLCDQVSAYG
FITEGHERFSDHYYDTSWKRLIFYINHDFKLEREVWKRLHDEGIIRLYQRPGPGTAKAKN

Sequence length

600

Interactions

View interactions

	KEGG		Reactome
	Mucin type O-glycan biosynthesis Metabolic pathways		Sialic acid metabolism

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
NONORGANIC PSYCHOSIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSYCHOTIC DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ST6GALNAC1-related disorder	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (36)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Arthritis	Arthritis	Pubtator	32483203	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	23567325, 28903359		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	31595388		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	19287074	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	23567325, 28903359		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	30996686		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	31831633	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	31831633		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	29348846		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	39348343	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	26927062		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	30753458		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal disease	Pubtator	25867765	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	20724461, 31595388		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	26927062		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	30996686		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	25532910		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	23567325, 28903359		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	25532910, 27835877, 28382513, 29348846		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	31831633		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	16319059		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	25860962		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nonorganic psychosis	Nonorganic Psychosis	PSYGENET_DG	21908516		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ovarian neoplasm	Ovarian neoplasm	BEFREE	30996686		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	27428423	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	PSYGENET_DG	21908516		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psychotic Disorders	Psychotic disorders	Pubtator	21908516	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	BEFREE	21908516		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	21908516		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	21908516	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	28035351		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	25532910		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	29729225	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	31831633		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	24656965	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ventricular hypertrophy	Ventricular hypertrophy	BEFREE	30854566		★★★★★ ★☆☆☆☆ Found in Text Mining only

ST6GALNAC1 (ST6 N-acetylgalactosaminide alpha-2,6-sialyltransferase 1)