Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	55803
Gene name	ArfGAP with dual PH domains 2
Gene symbol	ADAP2
Synonyms (NCBI Gene)	CENTA2HSA272195cent-b
Chromosome	17
Chromosome location	17q11.2
Summary	The protein encoded by this gene binds beta-tubulin and increases the stability of microtubules. The encoded protein can also translocate to the cell membrane and bind phosphatidylinositol 3,4,5-trisphosphate (PtdInsP3) and inositol 1,3,4,5-tetrakisphosph

Show/Hide all (81)

miRTarBase ID	miRNA	Experiments	Reference
MIRT029470	hsa-miR-26b-5p	Microarray	19088304
MIRT047793	hsa-miR-30d-5p	CLASH	23622248
MIRT037704	hsa-miR-744-5p	CLASH	23622248
MIRT710677	hsa-miR-4438	HITS-CLIP	19536157
MIRT710676	hsa-miR-7153-3p	HITS-CLIP	19536157
MIRT710675	hsa-miR-664a-3p	HITS-CLIP	19536157
MIRT710674	hsa-miR-3199	HITS-CLIP	19536157
MIRT710673	hsa-miR-8052	HITS-CLIP	19536157
MIRT710672	hsa-miR-365a-5p	HITS-CLIP	19536157
MIRT710671	hsa-miR-365b-5p	HITS-CLIP	19536157
MIRT710670	hsa-miR-5095	HITS-CLIP	19536157
MIRT710669	hsa-miR-7151-3p	HITS-CLIP	19536157
MIRT710677	hsa-miR-4438	HITS-CLIP	19536157
MIRT710676	hsa-miR-7153-3p	HITS-CLIP	19536157
MIRT710675	hsa-miR-664a-3p	HITS-CLIP	19536157
MIRT710674	hsa-miR-3199	HITS-CLIP	19536157
MIRT710673	hsa-miR-8052	HITS-CLIP	19536157
MIRT710672	hsa-miR-365a-5p	HITS-CLIP	19536157
MIRT710671	hsa-miR-365b-5p	HITS-CLIP	19536157
MIRT710670	hsa-miR-5095	HITS-CLIP	19536157
MIRT710669	hsa-miR-7151-3p	HITS-CLIP	19536157
MIRT767037	hsa-miR-1827	CLIP-seq
MIRT767038	hsa-miR-1910	CLIP-seq
MIRT767039	hsa-miR-3166	CLIP-seq
MIRT767040	hsa-miR-323-5p	CLIP-seq
MIRT767041	hsa-miR-4317	CLIP-seq
MIRT767042	hsa-miR-4326	CLIP-seq
MIRT767043	hsa-miR-455-3p	CLIP-seq
MIRT767044	hsa-miR-4676-5p	CLIP-seq
MIRT767045	hsa-miR-4706	CLIP-seq
MIRT767046	hsa-miR-4734	CLIP-seq
MIRT767047	hsa-miR-4749-5p	CLIP-seq
MIRT767048	hsa-miR-541	CLIP-seq
MIRT767049	hsa-miR-552	CLIP-seq
MIRT767050	hsa-miR-575	CLIP-seq
MIRT767051	hsa-miR-583	CLIP-seq
MIRT767052	hsa-miR-654-5p	CLIP-seq
MIRT767053	hsa-miR-744	CLIP-seq
MIRT767054	hsa-miR-885-3p	CLIP-seq
MIRT767055	hsa-miR-935	CLIP-seq
MIRT1925943	hsa-miR-1275	CLIP-seq
MIRT1925944	hsa-miR-1305	CLIP-seq
MIRT1925945	hsa-miR-18a	CLIP-seq
MIRT1925946	hsa-miR-18b	CLIP-seq
MIRT1925947	hsa-miR-2115	CLIP-seq
MIRT1925948	hsa-miR-3180-5p	CLIP-seq
MIRT1925949	hsa-miR-4525	CLIP-seq
MIRT1925950	hsa-miR-4665-5p	CLIP-seq
MIRT1925951	hsa-miR-4723-5p	CLIP-seq
MIRT1925952	hsa-miR-4735-3p	CLIP-seq
MIRT1925953	hsa-miR-4761-5p	CLIP-seq
MIRT1925954	hsa-miR-498	CLIP-seq
MIRT1925955	hsa-miR-516a-3p	CLIP-seq
MIRT1925956	hsa-miR-520a-5p	CLIP-seq
MIRT1925957	hsa-miR-525-5p	CLIP-seq
MIRT1925958	hsa-miR-625	CLIP-seq
MIRT2167290	hsa-miR-1	CLIP-seq
MIRT2167291	hsa-miR-1909	CLIP-seq
MIRT2167292	hsa-miR-206	CLIP-seq
MIRT2167293	hsa-miR-216a	CLIP-seq
MIRT2167294	hsa-miR-3115	CLIP-seq
MIRT2167295	hsa-miR-3155	CLIP-seq
MIRT2167296	hsa-miR-3155b	CLIP-seq
MIRT2167297	hsa-miR-3652	CLIP-seq
MIRT2167298	hsa-miR-3673	CLIP-seq
MIRT2167299	hsa-miR-3919	CLIP-seq
MIRT2167300	hsa-miR-3945	CLIP-seq
MIRT2167301	hsa-miR-4253	CLIP-seq
MIRT2167302	hsa-miR-4423-5p	CLIP-seq
MIRT2167303	hsa-miR-4430	CLIP-seq
MIRT2167304	hsa-miR-4652-5p	CLIP-seq
MIRT2167305	hsa-miR-4756-3p	CLIP-seq
MIRT2167306	hsa-miR-4781-3p	CLIP-seq
MIRT2167307	hsa-miR-484	CLIP-seq
MIRT2167308	hsa-miR-613	CLIP-seq
MIRT2167309	hsa-miR-615-5p	CLIP-seq
MIRT2167310	hsa-miR-652	CLIP-seq
MIRT767038	hsa-miR-1910	CLIP-seq
MIRT2443176	hsa-miR-4420	CLIP-seq
MIRT767043	hsa-miR-455-3p	CLIP-seq
MIRT2443177	hsa-miR-4755-3p	CLIP-seq

Show/Hide all (25)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005096	Function	GTPase activator activity	IBA
GO:0005096	Function	GTPase activator activity	IEA
GO:0005515	Function	Protein binding	IPI	20098747
GO:0005546	Function	Phosphatidylinositol-4,5-bisphosphate binding	ISS	12018390
GO:0005547	Function	Phosphatidylinositol-3,4,5-trisphosphate binding	IBA
GO:0005547	Function	Phosphatidylinositol-3,4,5-trisphosphate binding	IDA	14690521
GO:0005547	Function	Phosphatidylinositol-3,4,5-trisphosphate binding	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	14690521
GO:0005737	Component	Cytoplasm	IEA
GO:0005740	Component	Mitochondrial envelope	ISS	12018390
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	14690521
GO:0005886	Component	Plasma membrane	IEA
GO:0007507	Process	Heart development	IBA
GO:0007507	Process	Heart development	IEP	16138909
GO:0008270	Function	Zinc ion binding	IEA
GO:0016020	Component	Membrane	IEA
GO:0030674	Function	Protein-macromolecule adaptor activity	NAS	14690521
GO:0043231	Component	Intracellular membrane-bounded organelle	IBA
GO:0043325	Function	Phosphatidylinositol-3,4-bisphosphate binding	ISS	12018390
GO:0043533	Function	Inositol 1,3,4,5 tetrakisphosphate binding	IDA	14690521
GO:0043533	Function	Inositol 1,3,4,5 tetrakisphosphate binding	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:1902936	Function	Phosphatidylinositol bisphosphate binding	IEA

MIM	HGNC	e!Ensembl
608635	16487	ENSG00000184060

Q9NPF8

Protein name

Arf-GAP with dual PH domain-containing protein 2 (Centaurin-alpha-2) (Cnt-a2)

Protein function

GTPase-activating protein for the ADP ribosylation factor family (Potential). Binds phosphatidylinositol 3,4,5-trisphosphate (PtdInsP3) and inositol 1,3,4,5-tetrakisphosphate (InsP4). Possesses a stoichiometry of two binding sites for InsP4 with

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01412	ArfGap	8 → 126	Putative GTPase activating protein for Arf	Domain
PF00169	PH	133 → 232	PH domain	Domain
PF00169	PH	256 → 361	PH domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in placenta, spleen, kidney, skeletal muscle and adrenal gland. Weakly expressed in thyroid, liver, heart, lung, small intestine, peripheral blood leukocytes. Not detected in spinal cord, brain, stomach, trachea, colon

Sequence

MGDRERNKKRLLELLRAPDTGNAHCADCGAADPDWASYKLGIFICLNCCGVHRNFPDISR
VKSVRLDFWDDSIVEFMIHNGNLRVKAKFEARVPAFYYIPQANDCLVLKEQWIRAKYERR
EFMADGETISLPGNREGFLWKRGRDNSQFLRRKFVLLAREGLLKYFTKEQGKSPKAVISI
KDLNATFQTEKIGHPHGLQITYRRDGHTRNLFVYHESGKEIVDWFNALRAARLQYLKMAF
PELPESELVPFLTRNYLKQGFMEKTGPKQKEPFKKRWFALDCHERRLLYYKNPLDAFEQG
QVFLGNKEQGYEAYEDLPKGIRGNRWKAGLTIVTPERRFVLTCPSEKEQQEWLESLRGVL
SSPLTPLNRLTASTESGRSSR

Sequence length

381

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (5)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BENIGN THYROID GLAND NEOPLASM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESTROGEN-RECEPTOR NEGATIVE BREAST CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESTROGEN-RECEPTOR POSITIVE BREAST CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (9)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	37794108	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Heart Defects	Congenital heart defects	BEFREE	24711647		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Intellectual developmental disorder	Pubtator	11468690	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	20844836		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Peripheral Nerve Sheath Tumor	Malignant Peripheral Nerve Sheath Tumor	BEFREE	20844836		★★★★★ ★☆☆☆☆ Found in Text Mining only
neurofibroma	Neurofibroma	BEFREE	18850118		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 1	Neurofibromatosis	LHGDN	14690521		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurofibrosarcoma	Neurofibrosarcoma	Pubtator	20844836	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
NF1 Microdeletion Syndrome	NF1 Microdeletion Syndrome	BEFREE	24711647		★★★★★ ★☆☆☆☆ Found in Text Mining only

ADAP2 (ArfGAP with dual PH domains 2)