SCN3B (sodium voltage-gated channel beta subunit 3)

Gene

• Entrez ID: 55800
• Gene name: Sodium voltage-gated channel beta subunit 3
• Gene symbol: SCN3B
• Synonyms (NCBI Gene): ATFB16, BRGDA7, HSA243396, SCNB3
• Chromosome: 11
• Chromosome location: 11q24.1
• Summary: Voltage-gated sodium channels are transmembrane glycoprotein complexes composed of a large alpha subunit and one or more regulatory beta subunits. They are responsible for the generation and propagation of action potentials in neurons and muscle. This gen

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs147205617	C>T	Likely-benign, uncertain-significance, pathogenic, conflicting-interpretations-of-pathogenicity	Missense variant, coding sequence variant
rs587777556	G>A,T	Pathogenic, uncertain-significance	Coding sequence variant, missense variant
rs587777557	A>G	Pathogenic	Coding sequence variant, missense variant
rs771342044	A>C	Conflicting-interpretations-of-pathogenicity	Coding sequence variant, missense variant
rs879253730	G>C	Pathogenic	Missense variant, coding sequence variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT018656	hsa-miR-335-5p	Microarray	18185580
MIRT680912	hsa-miR-1910-3p	HITS-CLIP	23706177
MIRT680911	hsa-miR-6511a-5p	HITS-CLIP	23706177
MIRT680910	hsa-miR-4257	HITS-CLIP	23706177
MIRT680909	hsa-miR-4537	HITS-CLIP	23706177
MIRT680908	hsa-miR-1827	HITS-CLIP	23706177
MIRT680907	hsa-miR-377-5p	HITS-CLIP	23706177
MIRT680906	hsa-miR-6086	HITS-CLIP	23706177
MIRT680905	hsa-miR-2467-3p	HITS-CLIP	23706177
MIRT680904	hsa-miR-6499-3p	HITS-CLIP	23706177
MIRT680903	hsa-miR-455-3p	HITS-CLIP	23706177
MIRT680902	hsa-miR-6516-5p	HITS-CLIP	23706177
MIRT680908	hsa-miR-1827	PAR-CLIP	27292025
MIRT680908	hsa-miR-1827	PAR-CLIP	27292025
MIRT680912	hsa-miR-1910-3p	PAR-CLIP	27292025
MIRT680912	hsa-miR-1910-3p	PAR-CLIP	27292025
MIRT680905	hsa-miR-2467-3p	PAR-CLIP	27292025
MIRT680905	hsa-miR-2467-3p	PAR-CLIP	27292025
MIRT680907	hsa-miR-377-5p	PAR-CLIP	27292025
MIRT680907	hsa-miR-377-5p	PAR-CLIP	27292025
MIRT680910	hsa-miR-4257	PAR-CLIP	27292025
MIRT680910	hsa-miR-4257	PAR-CLIP	27292025
MIRT680909	hsa-miR-4537	PAR-CLIP	27292025
MIRT680909	hsa-miR-4537	PAR-CLIP	27292025
MIRT680903	hsa-miR-455-3p	PAR-CLIP	27292025
MIRT680903	hsa-miR-455-3p	PAR-CLIP	27292025
MIRT680906	hsa-miR-6086	PAR-CLIP	27292025
MIRT680906	hsa-miR-6086	PAR-CLIP	27292025
MIRT680904	hsa-miR-6499-3p	PAR-CLIP	27292025
MIRT680904	hsa-miR-6499-3p	PAR-CLIP	27292025
MIRT680911	hsa-miR-6511a-5p	PAR-CLIP	27292025
MIRT680911	hsa-miR-6511a-5p	PAR-CLIP	27292025
MIRT680902	hsa-miR-6516-5p	PAR-CLIP	27292025
MIRT680902	hsa-miR-6516-5p	PAR-CLIP	27292025
MIRT680912	hsa-miR-1910-3p	HITS-CLIP	23706177
MIRT680911	hsa-miR-6511a-5p	HITS-CLIP	23706177
MIRT680910	hsa-miR-4257	HITS-CLIP	23706177
MIRT680909	hsa-miR-4537	HITS-CLIP	23706177
MIRT680908	hsa-miR-1827	HITS-CLIP	23706177
MIRT680907	hsa-miR-377-5p	HITS-CLIP	23706177
MIRT680906	hsa-miR-6086	HITS-CLIP	23706177
MIRT680905	hsa-miR-2467-3p	HITS-CLIP	23706177
MIRT680904	hsa-miR-6499-3p	HITS-CLIP	23706177
MIRT680903	hsa-miR-455-3p	HITS-CLIP	23706177
MIRT680902	hsa-miR-6516-5p	HITS-CLIP	23706177
MIRT1329987	hsa-miR-1228	CLIP-seq
MIRT1329988	hsa-miR-1253	CLIP-seq
MIRT1329989	hsa-miR-1273	CLIP-seq
MIRT1329990	hsa-miR-1293	CLIP-seq
MIRT1329991	hsa-miR-1304	CLIP-seq
MIRT1329992	hsa-miR-2114	CLIP-seq
MIRT1329993	hsa-miR-2467-5p	CLIP-seq
MIRT1329994	hsa-miR-31	CLIP-seq
MIRT1329995	hsa-miR-3124-3p	CLIP-seq
MIRT1329996	hsa-miR-3153	CLIP-seq
MIRT1329997	hsa-miR-3183	CLIP-seq
MIRT1329998	hsa-miR-3188	CLIP-seq
MIRT1329999	hsa-miR-323-5p	CLIP-seq
MIRT1330000	hsa-miR-3655	CLIP-seq
MIRT1330001	hsa-miR-3679-3p	CLIP-seq
MIRT1330002	hsa-miR-3683	CLIP-seq
MIRT1330003	hsa-miR-3975	CLIP-seq
MIRT1330004	hsa-miR-4278	CLIP-seq
MIRT1330005	hsa-miR-4292	CLIP-seq
MIRT1330006	hsa-miR-4308	CLIP-seq
MIRT1330007	hsa-miR-4426	CLIP-seq
MIRT1330008	hsa-miR-4433	CLIP-seq
MIRT1330009	hsa-miR-4434	CLIP-seq
MIRT1330010	hsa-miR-4459	CLIP-seq
MIRT1330011	hsa-miR-4483	CLIP-seq
MIRT1330012	hsa-miR-4486	CLIP-seq
MIRT1330013	hsa-miR-4516	CLIP-seq
MIRT1330014	hsa-miR-4531	CLIP-seq
MIRT1330015	hsa-miR-4534	CLIP-seq
MIRT1330016	hsa-miR-4646-3p	CLIP-seq
MIRT1330017	hsa-miR-4646-5p	CLIP-seq
MIRT1330018	hsa-miR-4647	CLIP-seq
MIRT1330019	hsa-miR-4649-5p	CLIP-seq
MIRT1330020	hsa-miR-4662a-5p	CLIP-seq
MIRT1330021	hsa-miR-4662b	CLIP-seq
MIRT1330022	hsa-miR-4668-5p	CLIP-seq
MIRT1330023	hsa-miR-4676-5p	CLIP-seq
MIRT1330024	hsa-miR-4720-3p	CLIP-seq
MIRT1330025	hsa-miR-4723-3p	CLIP-seq
MIRT1330026	hsa-miR-4755-3p	CLIP-seq
MIRT1330027	hsa-miR-4768-3p	CLIP-seq
MIRT1330028	hsa-miR-4804-3p	CLIP-seq
MIRT1330029	hsa-miR-485-5p	CLIP-seq
MIRT1330030	hsa-miR-486-3p	CLIP-seq
MIRT1330031	hsa-miR-490-3p	CLIP-seq
MIRT1330032	hsa-miR-548g	CLIP-seq
MIRT1330033	hsa-miR-575	CLIP-seq
MIRT1330034	hsa-miR-579	CLIP-seq
MIRT1330035	hsa-miR-619	CLIP-seq
MIRT1330036	hsa-miR-661	CLIP-seq
MIRT1330037	hsa-miR-665	CLIP-seq
MIRT1330038	hsa-miR-759	CLIP-seq
MIRT1330039	hsa-miR-876-3p	CLIP-seq
MIRT1330040	hsa-miR-935	CLIP-seq
MIRT1330041	hsa-miR-10a	CLIP-seq
MIRT1330042	hsa-miR-10b	CLIP-seq
MIRT1330043	hsa-miR-1225-3p	CLIP-seq
MIRT1329987	hsa-miR-1228	CLIP-seq
MIRT1330044	hsa-miR-1233	CLIP-seq
MIRT1330045	hsa-miR-1251	CLIP-seq
MIRT1330046	hsa-miR-1255a	CLIP-seq
MIRT1330047	hsa-miR-1255b	CLIP-seq
MIRT1330048	hsa-miR-1290	CLIP-seq
MIRT1329991	hsa-miR-1304	CLIP-seq
MIRT1330049	hsa-miR-1322	CLIP-seq
MIRT1329993	hsa-miR-2467-5p	CLIP-seq
MIRT1330050	hsa-miR-2964a-3p	CLIP-seq
MIRT1330051	hsa-miR-302f	CLIP-seq
MIRT1330052	hsa-miR-3120-5p	CLIP-seq
MIRT1330053	hsa-miR-3135	CLIP-seq
MIRT1330054	hsa-miR-3140-3p	CLIP-seq
MIRT1330055	hsa-miR-3162-5p	CLIP-seq
MIRT1329998	hsa-miR-3188	CLIP-seq
MIRT1330056	hsa-miR-320e	CLIP-seq
MIRT1329999	hsa-miR-323-5p	CLIP-seq
MIRT1330057	hsa-miR-339-5p	CLIP-seq
MIRT1330058	hsa-miR-3622b-5p	CLIP-seq
MIRT1330003	hsa-miR-3975	CLIP-seq
MIRT1330059	hsa-miR-4421	CLIP-seq
MIRT1330008	hsa-miR-4433	CLIP-seq
MIRT1330060	hsa-miR-4464	CLIP-seq
MIRT1330061	hsa-miR-4645-5p	CLIP-seq
MIRT1330020	hsa-miR-4662a-5p	CLIP-seq
MIRT1330062	hsa-miR-4673	CLIP-seq
MIRT1330023	hsa-miR-4676-5p	CLIP-seq
MIRT1330063	hsa-miR-4680-3p	CLIP-seq
MIRT1330024	hsa-miR-4720-3p	CLIP-seq
MIRT1330064	hsa-miR-4729	CLIP-seq
MIRT1330065	hsa-miR-4748	CLIP-seq
MIRT1330026	hsa-miR-4755-3p	CLIP-seq
MIRT1330066	hsa-miR-4793-3p	CLIP-seq
MIRT1330067	hsa-miR-4797-5p	CLIP-seq
MIRT1330028	hsa-miR-4804-3p	CLIP-seq
MIRT1330029	hsa-miR-485-5p	CLIP-seq
MIRT1330030	hsa-miR-486-3p	CLIP-seq
MIRT1330031	hsa-miR-490-3p	CLIP-seq
MIRT1330068	hsa-miR-542-3p	CLIP-seq
MIRT1330069	hsa-miR-548c-3p	CLIP-seq
MIRT1330033	hsa-miR-575	CLIP-seq
MIRT1330034	hsa-miR-579	CLIP-seq
MIRT1330070	hsa-miR-580	CLIP-seq
MIRT1330036	hsa-miR-661	CLIP-seq
MIRT1330037	hsa-miR-665	CLIP-seq
MIRT1330039	hsa-miR-876-3p	CLIP-seq
MIRT2097779	hsa-miR-1972	CLIP-seq
MIRT2097780	hsa-miR-198	CLIP-seq
MIRT2097781	hsa-miR-2964a-5p	CLIP-seq
MIRT2097782	hsa-miR-3180-5p	CLIP-seq
MIRT2097783	hsa-miR-520a-5p	CLIP-seq
MIRT2097784	hsa-miR-525-5p	CLIP-seq
MIRT1329987	hsa-miR-1228	CLIP-seq
MIRT1330045	hsa-miR-1251	CLIP-seq
MIRT1329989	hsa-miR-1273	CLIP-seq
MIRT1329990	hsa-miR-1293	CLIP-seq
MIRT1329991	hsa-miR-1304	CLIP-seq
MIRT1329992	hsa-miR-2114	CLIP-seq
MIRT2322082	hsa-miR-3065-3p	CLIP-seq
MIRT2322083	hsa-miR-3122	CLIP-seq
MIRT1330053	hsa-miR-3135	CLIP-seq
MIRT2322084	hsa-miR-3192	CLIP-seq
MIRT1329999	hsa-miR-323-5p	CLIP-seq
MIRT2322085	hsa-miR-3614-5p	CLIP-seq
MIRT1330002	hsa-miR-3683	CLIP-seq
MIRT2322086	hsa-miR-3689a-3p	CLIP-seq
MIRT2322087	hsa-miR-3689c	CLIP-seq
MIRT2322088	hsa-miR-3913-5p	CLIP-seq
MIRT2322089	hsa-miR-3929	CLIP-seq
MIRT2322090	hsa-miR-4282	CLIP-seq
MIRT2322091	hsa-miR-4293	CLIP-seq
MIRT2322092	hsa-miR-4419b	CLIP-seq
MIRT1330008	hsa-miR-4433	CLIP-seq
MIRT1330009	hsa-miR-4434	CLIP-seq
MIRT1330010	hsa-miR-4459	CLIP-seq
MIRT2322093	hsa-miR-4478	CLIP-seq
MIRT1330011	hsa-miR-4483	CLIP-seq
MIRT1330012	hsa-miR-4486	CLIP-seq
MIRT2322094	hsa-miR-4488	CLIP-seq
MIRT1330013	hsa-miR-4516	CLIP-seq
MIRT1330014	hsa-miR-4531	CLIP-seq
MIRT2322095	hsa-miR-4535	CLIP-seq
MIRT1330019	hsa-miR-4649-5p	CLIP-seq
MIRT2322096	hsa-miR-4656	CLIP-seq
MIRT1330020	hsa-miR-4662a-5p	CLIP-seq
MIRT1330023	hsa-miR-4676-5p	CLIP-seq
MIRT2322097	hsa-miR-4697-5p	CLIP-seq
MIRT2322098	hsa-miR-4728-5p	CLIP-seq
MIRT1330026	hsa-miR-4755-3p	CLIP-seq
MIRT1330027	hsa-miR-4768-3p	CLIP-seq
MIRT2322099	hsa-miR-4776-5p	CLIP-seq
MIRT1330066	hsa-miR-4793-3p	CLIP-seq
MIRT1330067	hsa-miR-4797-5p	CLIP-seq
MIRT1330029	hsa-miR-485-5p	CLIP-seq
MIRT2322100	hsa-miR-492	CLIP-seq
MIRT1330033	hsa-miR-575	CLIP-seq
MIRT1330034	hsa-miR-579	CLIP-seq
MIRT2322101	hsa-miR-589	CLIP-seq
MIRT2322102	hsa-miR-596	CLIP-seq
MIRT1330035	hsa-miR-619	CLIP-seq
MIRT2322103	hsa-miR-637	CLIP-seq
MIRT1330036	hsa-miR-661	CLIP-seq
MIRT1330037	hsa-miR-665	CLIP-seq
MIRT2322104	hsa-miR-668	CLIP-seq
MIRT2322105	hsa-miR-767-5p	CLIP-seq
MIRT1330039	hsa-miR-876-3p	CLIP-seq
MIRT2322106	hsa-miR-890	CLIP-seq
MIRT1330040	hsa-miR-935	CLIP-seq
MIRT1329993	hsa-miR-2467-5p	CLIP-seq
MIRT1329998	hsa-miR-3188	CLIP-seq
MIRT1330003	hsa-miR-3975	CLIP-seq
MIRT2322107	hsa-miR-4455	CLIP-seq
MIRT1329987	hsa-miR-1228	CLIP-seq
MIRT1330045	hsa-miR-1251	CLIP-seq
MIRT1329991	hsa-miR-1304	CLIP-seq
MIRT1330050	hsa-miR-2964a-3p	CLIP-seq
MIRT1330051	hsa-miR-302f	CLIP-seq
MIRT1330053	hsa-miR-3135	CLIP-seq
MIRT2394090	hsa-miR-370	CLIP-seq
MIRT2394091	hsa-miR-3926	CLIP-seq
MIRT2322091	hsa-miR-4293	CLIP-seq
MIRT1330008	hsa-miR-4433	CLIP-seq
MIRT1330010	hsa-miR-4459	CLIP-seq
MIRT1330027	hsa-miR-4768-3p	CLIP-seq
MIRT1330066	hsa-miR-4793-3p	CLIP-seq
MIRT1330068	hsa-miR-542-3p	CLIP-seq
MIRT2394092	hsa-miR-548s	CLIP-seq
MIRT1330034	hsa-miR-579	CLIP-seq
MIRT1330070	hsa-miR-580	CLIP-seq
MIRT2322102	hsa-miR-596	CLIP-seq
MIRT1330036	hsa-miR-661	CLIP-seq
MIRT1330041	hsa-miR-10a	CLIP-seq
MIRT1330042	hsa-miR-10b	CLIP-seq
MIRT1330045	hsa-miR-1251	CLIP-seq
MIRT1329988	hsa-miR-1253	CLIP-seq
MIRT1329989	hsa-miR-1273	CLIP-seq
MIRT1329990	hsa-miR-1293	CLIP-seq
MIRT2097779	hsa-miR-1972	CLIP-seq
MIRT1329992	hsa-miR-2114	CLIP-seq
MIRT2618491	hsa-miR-214	CLIP-seq
MIRT2618492	hsa-miR-216a	CLIP-seq
MIRT2618493	hsa-miR-216b	CLIP-seq
MIRT1329993	hsa-miR-2467-5p	CLIP-seq
MIRT2322082	hsa-miR-3065-3p	CLIP-seq
MIRT1329994	hsa-miR-31	CLIP-seq
MIRT1330052	hsa-miR-3120-5p	CLIP-seq
MIRT2322083	hsa-miR-3122	CLIP-seq
MIRT1329998	hsa-miR-3188	CLIP-seq
MIRT1330057	hsa-miR-339-5p	CLIP-seq
MIRT2618494	hsa-miR-3613-3p	CLIP-seq
MIRT2618495	hsa-miR-3619-5p	CLIP-seq
MIRT2618496	hsa-miR-3672	CLIP-seq
MIRT1330002	hsa-miR-3683	CLIP-seq
MIRT2322086	hsa-miR-3689a-3p	CLIP-seq
MIRT2322087	hsa-miR-3689c	CLIP-seq
MIRT2618497	hsa-miR-371-5p	CLIP-seq
MIRT2618498	hsa-miR-371b-5p	CLIP-seq
MIRT2322088	hsa-miR-3913-5p	CLIP-seq
MIRT2322089	hsa-miR-3929	CLIP-seq
MIRT2618499	hsa-miR-3974	CLIP-seq
MIRT1330003	hsa-miR-3975	CLIP-seq
MIRT2322090	hsa-miR-4282	CLIP-seq
MIRT2618500	hsa-miR-4291	CLIP-seq
MIRT2322092	hsa-miR-4419b	CLIP-seq
MIRT1330059	hsa-miR-4421	CLIP-seq
MIRT1330009	hsa-miR-4434	CLIP-seq
MIRT2322093	hsa-miR-4478	CLIP-seq
MIRT1330011	hsa-miR-4483	CLIP-seq
MIRT1330012	hsa-miR-4486	CLIP-seq
MIRT1330013	hsa-miR-4516	CLIP-seq
MIRT1330014	hsa-miR-4531	CLIP-seq
MIRT2618501	hsa-miR-4649-3p	CLIP-seq
MIRT1330019	hsa-miR-4649-5p	CLIP-seq
MIRT2618502	hsa-miR-4650-5p	CLIP-seq
MIRT2618503	hsa-miR-4670-3p	CLIP-seq
MIRT2618504	hsa-miR-4696	CLIP-seq
MIRT2322098	hsa-miR-4728-5p	CLIP-seq
MIRT2618505	hsa-miR-4761-5p	CLIP-seq
MIRT1330066	hsa-miR-4793-3p	CLIP-seq
MIRT1330029	hsa-miR-485-5p	CLIP-seq
MIRT2618506	hsa-miR-493	CLIP-seq
MIRT1330069	hsa-miR-548c-3p	CLIP-seq
MIRT1330070	hsa-miR-580	CLIP-seq
MIRT1330035	hsa-miR-619	CLIP-seq
MIRT1330036	hsa-miR-661	CLIP-seq
MIRT2618507	hsa-miR-761	CLIP-seq
MIRT2618508	hsa-miR-922	CLIP-seq
MIRT1330040	hsa-miR-935	CLIP-seq
MIRT1330041	hsa-miR-10a	CLIP-seq
MIRT1330042	hsa-miR-10b	CLIP-seq
MIRT1330045	hsa-miR-1251	CLIP-seq
MIRT1329988	hsa-miR-1253	CLIP-seq
MIRT1329990	hsa-miR-1293	CLIP-seq
MIRT2097779	hsa-miR-1972	CLIP-seq
MIRT2618491	hsa-miR-214	CLIP-seq
MIRT2618492	hsa-miR-216a	CLIP-seq
MIRT2618493	hsa-miR-216b	CLIP-seq
MIRT1329993	hsa-miR-2467-5p	CLIP-seq
MIRT2322082	hsa-miR-3065-3p	CLIP-seq
MIRT1330052	hsa-miR-3120-5p	CLIP-seq
MIRT2322083	hsa-miR-3122	CLIP-seq
MIRT1330053	hsa-miR-3135	CLIP-seq
MIRT1329998	hsa-miR-3188	CLIP-seq
MIRT1330057	hsa-miR-339-5p	CLIP-seq
MIRT2618494	hsa-miR-3613-3p	CLIP-seq
MIRT2618495	hsa-miR-3619-5p	CLIP-seq
MIRT2618496	hsa-miR-3672	CLIP-seq
MIRT2322086	hsa-miR-3689a-3p	CLIP-seq
MIRT2322087	hsa-miR-3689c	CLIP-seq
MIRT2618497	hsa-miR-371-5p	CLIP-seq
MIRT2618498	hsa-miR-371b-5p	CLIP-seq
MIRT2322088	hsa-miR-3913-5p	CLIP-seq
MIRT2322089	hsa-miR-3929	CLIP-seq
MIRT2618499	hsa-miR-3974	CLIP-seq
MIRT1330003	hsa-miR-3975	CLIP-seq
MIRT2322090	hsa-miR-4282	CLIP-seq
MIRT2618500	hsa-miR-4291	CLIP-seq
MIRT2322092	hsa-miR-4419b	CLIP-seq
MIRT1330059	hsa-miR-4421	CLIP-seq
MIRT1330009	hsa-miR-4434	CLIP-seq
MIRT2322093	hsa-miR-4478	CLIP-seq
MIRT1330011	hsa-miR-4483	CLIP-seq
MIRT1330013	hsa-miR-4516	CLIP-seq
MIRT1330014	hsa-miR-4531	CLIP-seq
MIRT2618501	hsa-miR-4649-3p	CLIP-seq
MIRT2618502	hsa-miR-4650-5p	CLIP-seq
MIRT2618503	hsa-miR-4670-3p	CLIP-seq
MIRT2322098	hsa-miR-4728-5p	CLIP-seq
MIRT2618505	hsa-miR-4761-5p	CLIP-seq
MIRT1330066	hsa-miR-4793-3p	CLIP-seq
MIRT1330029	hsa-miR-485-5p	CLIP-seq
MIRT2618506	hsa-miR-493	CLIP-seq
MIRT1330068	hsa-miR-542-3p	CLIP-seq
MIRT1330069	hsa-miR-548c-3p	CLIP-seq
MIRT1330070	hsa-miR-580	CLIP-seq
MIRT2618507	hsa-miR-761	CLIP-seq
MIRT2618508	hsa-miR-922	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001518	Component	Voltage-gated sodium channel complex	IBA
GO:0001518	Component	Voltage-gated sodium channel complex	IDA	20042427, 21051419, 24567321
GO:0001518	Component	Voltage-gated sodium channel complex	IEA
GO:0001518	Component	Voltage-gated sodium channel complex	TAS	21895525
GO:0005272	Function	Sodium channel activity	IEA
GO:0005515	Function	Protein binding	IPI	28514442, 32296183, 33961781, 35301303
GO:0005829	Component	Cytosol	IDA
GO:0005886	Component	Plasma membrane	IDA	24567321
GO:0005886	Component	Plasma membrane	IEA
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006814	Process	Sodium ion transport	IEA
GO:0006814	Process	Sodium ion transport	NAS	10688874
GO:0007399	Process	Nervous system development	IEA
GO:0010460	Process	Positive regulation of heart rate	IEA
GO:0010460	Process	Positive regulation of heart rate	ISS
GO:0010765	Process	Positive regulation of sodium ion transport	IDA	20042427
GO:0010765	Process	Positive regulation of sodium ion transport	IMP	21051419
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	NAS	10688874
GO:0017080	Function	Sodium channel regulator activity	IDA	20226894
GO:0017080	Function	Sodium channel regulator activity	IEA
GO:0017080	Function	Sodium channel regulator activity	IMP	20042427, 21051419
GO:0019871	Function	Sodium channel inhibitor activity	IBA
GO:0030018	Component	Z disc	IEA
GO:0030018	Component	Z disc	ISS
GO:0034220	Process	Monoatomic ion transmembrane transport	IEA
GO:0034702	Component	Monoatomic ion channel complex	IEA
GO:0035725	Process	Sodium ion transmembrane transport	IBA
GO:0035725	Process	Sodium ion transmembrane transport	IDA	20226894
GO:0044325	Function	Transmembrane transporter binding	IBA
GO:0044325	Function	Transmembrane transporter binding	IEA
GO:0044325	Function	Transmembrane transporter binding	IPI	20042427
GO:0051899	Process	Membrane depolarization	IDA	21051419
GO:0060048	Process	Cardiac muscle contraction	IMP	20042427, 21051419
GO:0060371	Process	Regulation of atrial cardiac muscle cell membrane depolarization	IEA
GO:0060371	Process	Regulation of atrial cardiac muscle cell membrane depolarization	IMP	21051419
GO:0060373	Process	Regulation of ventricular cardiac muscle cell membrane depolarization	IMP	20042427
GO:0061337	Process	Cardiac conduction	IEA
GO:0072659	Process	Protein localization to plasma membrane	IMP	20042427
GO:0086002	Process	Cardiac muscle cell action potential involved in contraction	IMP	21051419
GO:0086005	Process	Ventricular cardiac muscle cell action potential	IBA
GO:0086005	Process	Ventricular cardiac muscle cell action potential	IEA
GO:0086005	Process	Ventricular cardiac muscle cell action potential	IMP	20042427
GO:0086006	Function	Voltage-gated sodium channel activity involved in cardiac muscle cell action potential	IEA
GO:0086010	Process	Membrane depolarization during action potential	IDA	20042427, 20226894
GO:0086010	Process	Membrane depolarization during action potential	IMP	21051419
GO:0086012	Process	Membrane depolarization during cardiac muscle cell action potential	IBA
GO:0086012	Process	Membrane depolarization during cardiac muscle cell action potential	IMP	21051419
GO:0086014	Process	Atrial cardiac muscle cell action potential	IMP	21051419
GO:0086015	Process	SA node cell action potential	IEA
GO:0086015	Process	SA node cell action potential	ISS
GO:0086091	Process	Regulation of heart rate by cardiac conduction	IBA
GO:0086091	Process	Regulation of heart rate by cardiac conduction	IMP	20042427, 21051419

Other IDs

• MIM: 608214
• HGNC: 20665
• e!Ensembl: ENSG00000166257

Protein

• UniProt ID: Q9NY72
• Protein name: Sodium channel regulatory subunit beta-3
• Protein function: Regulatory subunit of multiple voltage-gated sodium (Nav) channels directly mediating the depolarization of excitable membranes. Navs, also called VGSCs (voltage-gated sodium channels) or VDSCs (voltage-dependent sodium channels), operate by swi
• PDB: 4L1D, 7TJ8, 7TJ9
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF07686	V-set	28 → 143	Immunoglobulin V-set domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in the atrium. {ECO:0000269|PubMed:21051419}.
• Sequence:

  MPAFNRLFPLASLVLIYWVSVCFPVCVEVPSETEAVQGNPMKLRCISCMKREEVEATTVV
  EWFYRPEGGKDFLIYEYRNGHQEVESPFQGRLQWNGSKDLQDVSITVLNVTLNDSGLYTC
  NVSREFEFEAHRPFVKTTRLIPLRVTEEAGEDFTSVVSEIMMYILLVFLTLWLLIEMIYC
  YRKVSKAEEAAQENASDYLAIPSENKENSAVPVEE

• Sequence length: 215

Pathways

Reactome:

Phase 0 - rapid depolarisation

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Atrial fibrillation, familial, 16	Pathogenic	rs587777557, rs587777558	RCV000128814 RCV000128815	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Brugada syndrome	Conflicting classifications of pathogenicity; Uncertain significance	ClinVar ClinGen, Orphanet ClinGen, Orphanet	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
BRUGADA SYNDROME 1	—	ClinGen, Disgenet ClinGen, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brugada syndrome 7	Uncertain significance; Likely benign; Benign; Conflicting classifications of pathogenicity	ClinVar CTD, ClinVar, Disgenet, GenCC, HPO CTD, ClinVar, Disgenet, GenCC, HPO CTD, ClinVar, Disgenet, GenCC, HPO CTD, ClinVar, Disgenet, GenCC, HPO	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Cardiac arrhythmia	Uncertain significance	ClinVar Disgenet	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Cardiomyopathy	Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiovascular phenotype	Uncertain significance; Likely benign; Benign; Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Death in infancy	Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FAMILIAL ATRIAL FIBRILLATION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEREDITARY ATRIAL FIBRILLATION	—	Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Long QT syndrome	Uncertain significance	ClinVar Disgenet	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Ovarian serous cystadenocarcinoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOAFFECTIVE DISORDER-BIPOLAR TYPE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCN3B-related disorder	Likely benign; Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sudden cardiac death	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Atrial Fibrillation	Atrial Fibrillation	BEFREE	20558140, 21051419, 23604097, 30821358		★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	20558140, 30821358	Associate	★☆☆☆☆ Found in Text Mining only
ATRIAL FIBRILLATION, FAMILIAL, 1 (disorder)	Atrial Fibrillation	ORPHANET_DG	20558140, 21051419		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	31610812	Associate	★☆☆☆☆ Found in Text Mining only
Brugada Syndrome	Brugada syndrome	Pubtator	20031595, 39761910	Associate	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Brugada syndrome	Brugada Syndrome	Orphanet			★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Brugada Syndrome (disorder)	Brugada Syndrome	CLINGEN_DG	11744748, 15007009, 15455233, 19351516, 20031595, 20226894, 21051419, 23257389, 24529773, 26179811, 27677334		★☆☆☆☆ Found in Text Mining only
Brugada Syndrome (disorder)	Brugada Syndrome	BEFREE	20031595, 22284586, 23257389		★☆☆☆☆ Found in Text Mining only
Brugada Syndrome 1	Brugada Syndrome	CLINGEN_DG	11744748, 15007009, 15455233, 19351516, 20031595, 20226894, 21051419, 23257389, 24529773, 26179811, 27677334		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brugada Syndrome 7	Brugada Syndrome	UNIPROT_DG	20031595, 20558140, 21051419		★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Brugada Syndrome 7	Brugada Syndrome	GENOMICS_ENGLAND_DG	27761167		★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Brugada Syndrome 7	Brugada Syndrome	CTD_human_DG			★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Brugada Syndrome 7	Brugada Syndrome	CLINVAR_DG			★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
CARDIAC CONDUCTION DEFECT, NONSPECIFIC (disorder)	Cardiac conduction disease	CLINGEN_DG	11744748, 15007009, 15455233, 19351516, 20031595, 20226894, 21051419, 23257389, 24529773, 26179811, 27677334		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Edema	Edema	Pubtator	27487831	Stimulate	★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	26742644		★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	Pubtator	26742644	Associate	★☆☆☆☆ Found in Text Mining only
Familial atrial fibrillation	Atrial Fibrillation	Orphanet			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
First degree atrioventricular block	Atrioventricular block	HPO_DG			★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	35581384	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	31610812	Associate	★☆☆☆☆ Found in Text Mining only
Paroxysmal familial ventricular fibrillation	Paroxysmal ventricular fibrillation	BEFREE	20042427		★☆☆☆☆ Found in Text Mining only
Paroxysmal ventricular tachycardia	Paroxysmal ventricular tachycardia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Right bundle branch block	Bundle Branch Block	HPO_DG			★☆☆☆☆ Found in Text Mining only
Schizoaffective disorder, bipolar type	Schizoaffective Disorder	GWASCAT_DG	31043756		★☆☆☆☆ Found in Text Mining only
Sick Sinus Syndrome	Sick Sinus Syndrome	HPO_DG			★☆☆☆☆ Found in Text Mining only
Sinus Node Dysfunction (disorder)	Sinus Node Dysfunction	CLINGEN_DG	11744748, 15007009, 15455233, 19351516, 20031595, 20226894, 21051419, 23257389, 24529773, 26179811, 27677334		★☆☆☆☆ Found in Text Mining only
Supraventricular tachycardia	Supraventricular tachycardia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Tonic - clonic seizures	Seizure	BEFREE	20730464		★☆☆☆☆ Found in Text Mining only
Trifascicular block	Trifascicular block	HPO_DG			★☆☆☆☆ Found in Text Mining only
Ventricular Fibrillation	Ventricular Fibrillation	HPO_DG			★☆☆☆☆ Found in Text Mining only
Ventricular Fibrillation, Paroxysmal Familial, 1	Ventricular Fibrillation	BEFREE	20042427		★☆☆☆☆ Found in Text Mining only