Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	558
Gene name	AXL receptor tyrosine kinase
Gene symbol	AXL
Synonyms (NCBI Gene)	ARKAXL3JTK11Tyro7UFO
Chromosome	19
Chromosome location	19q13.2
Summary	The protein encoded by this gene is a member of the Tyro3-Axl-Mer (TAM) receptor tyrosine kinase subfamily. The encoded protein possesses an extracellular domain which is composed of two immunoglobulin-like motifs at the N-terminal, followed by two fibron

Show/Hide all (1)

SNP ID	Visualize variation	Clinical significance	Consequence
rs1599744167	C>G	Likely-pathogenic	Coding sequence variant, missense variant

457

Show/Hide all (457)

miRTarBase ID	miRNA	Experiments	Reference
MIRT002758	hsa-miR-1-3p	pSILAC	18668040
MIRT002758	hsa-miR-1-3p	Microarray	15685193
MIRT006664	hsa-miR-34a-5p	Luciferase reporter assayqRT-PCRWestern blot	21814748
MIRT019798	hsa-miR-375	Microarray	20215506
MIRT020726	hsa-miR-155-5p	Proteomics	18668040
MIRT002758	hsa-miR-1-3p	Microarray;Other	15685193
MIRT002758	hsa-miR-1-3p	Proteomics	18668040
MIRT006664	hsa-miR-34a-5p	Reporter assay;Proteomics	21566225
MIRT438639	hsa-miR-122-5p	Luciferase reporter assay	24113455
MIRT438639	hsa-miR-122-5p	Luciferase reporter assay	24113455
MIRT707505	hsa-miR-548c-3p	HITS-CLIP	21572407
MIRT707504	hsa-miR-6732-3p	HITS-CLIP	21572407
MIRT707503	hsa-miR-10a-5p	HITS-CLIP	21572407
MIRT707502	hsa-miR-10b-5p	HITS-CLIP	21572407
MIRT707501	hsa-miR-3163	HITS-CLIP	21572407
MIRT707500	hsa-miR-339-5p	HITS-CLIP	21572407
MIRT707499	hsa-miR-4421	HITS-CLIP	21572407
MIRT707497	hsa-miR-5699-3p	HITS-CLIP	21572407
MIRT707498	hsa-miR-6895-3p	HITS-CLIP	21572407
MIRT707496	hsa-miR-593-3p	HITS-CLIP	21572407
MIRT707495	hsa-miR-4684-5p	HITS-CLIP	21572407
MIRT707494	hsa-miR-6818-3p	HITS-CLIP	21572407
MIRT006664	hsa-miR-34a-5p	ChIP-seqLuciferase reporter assayMicroarrayqRT-PCRWestern blot	26667302
MIRT006664	hsa-miR-34a-5p	Luciferase reporter assayqRT-PCR	26287733
MIRT006664	hsa-miR-34a-5p	Luciferase reporter assayqRT-PCR	26287733
MIRT736908	hsa-miR-34a-3p	Immunohistochemistry (IHC)RNA-seqImmunofluorescenceqRT-PCRIn situ hybridization	31752449
MIRT707505	hsa-miR-548c-3p	HITS-CLIP	21572407
MIRT707504	hsa-miR-6732-3p	HITS-CLIP	21572407
MIRT707503	hsa-miR-10a-5p	HITS-CLIP	21572407
MIRT707502	hsa-miR-10b-5p	HITS-CLIP	21572407
MIRT707501	hsa-miR-3163	HITS-CLIP	21572407
MIRT707500	hsa-miR-339-5p	HITS-CLIP	21572407
MIRT707499	hsa-miR-4421	HITS-CLIP	21572407
MIRT707497	hsa-miR-5699-3p	HITS-CLIP	21572407
MIRT707498	hsa-miR-6895-3p	HITS-CLIP	21572407
MIRT707496	hsa-miR-593-3p	HITS-CLIP	21572407
MIRT707495	hsa-miR-4684-5p	HITS-CLIP	21572407
MIRT707494	hsa-miR-6818-3p	HITS-CLIP	21572407
MIRT812449	hsa-miR-1228	CLIP-seq
MIRT812450	hsa-miR-1262	CLIP-seq
MIRT812451	hsa-miR-127-5p	CLIP-seq
MIRT812452	hsa-miR-128	CLIP-seq
MIRT812453	hsa-miR-216a	CLIP-seq
MIRT812454	hsa-miR-216b	CLIP-seq
MIRT812455	hsa-miR-24	CLIP-seq
MIRT812456	hsa-miR-3065-3p	CLIP-seq
MIRT812457	hsa-miR-3122	CLIP-seq
MIRT812458	hsa-miR-3123	CLIP-seq
MIRT812459	hsa-miR-329	CLIP-seq
MIRT812460	hsa-miR-3614-5p	CLIP-seq
MIRT812461	hsa-miR-362-3p	CLIP-seq
MIRT812462	hsa-miR-3672	CLIP-seq
MIRT812463	hsa-miR-3689a-3p	CLIP-seq
MIRT812464	hsa-miR-3689c	CLIP-seq
MIRT812465	hsa-miR-3913-5p	CLIP-seq
MIRT812466	hsa-miR-3919	CLIP-seq
MIRT812467	hsa-miR-3929	CLIP-seq
MIRT812468	hsa-miR-4284	CLIP-seq
MIRT812469	hsa-miR-4419b	CLIP-seq
MIRT812470	hsa-miR-4433	CLIP-seq
MIRT812471	hsa-miR-4455	CLIP-seq
MIRT812472	hsa-miR-4459	CLIP-seq
MIRT812473	hsa-miR-4477b	CLIP-seq
MIRT812474	hsa-miR-4478	CLIP-seq
MIRT812475	hsa-miR-4522	CLIP-seq
MIRT812476	hsa-miR-4539	CLIP-seq
MIRT812477	hsa-miR-4680-5p	CLIP-seq
MIRT812478	hsa-miR-4701-3p	CLIP-seq
MIRT812479	hsa-miR-4714-5p	CLIP-seq
MIRT812480	hsa-miR-4728-5p	CLIP-seq
MIRT812481	hsa-miR-4768-3p	CLIP-seq
MIRT812482	hsa-miR-4786-3p	CLIP-seq
MIRT812483	hsa-miR-4793-3p	CLIP-seq
MIRT812484	hsa-miR-485-5p	CLIP-seq
MIRT812485	hsa-miR-487a	CLIP-seq
MIRT812486	hsa-miR-493	CLIP-seq
MIRT812487	hsa-miR-508-5p	CLIP-seq
MIRT812488	hsa-miR-518d-5p	CLIP-seq
MIRT812489	hsa-miR-519b-5p	CLIP-seq
MIRT812490	hsa-miR-519c-5p	CLIP-seq
MIRT812491	hsa-miR-520c-5p	CLIP-seq
MIRT812492	hsa-miR-526a	CLIP-seq
MIRT812493	hsa-miR-541	CLIP-seq
MIRT812494	hsa-miR-600	CLIP-seq
MIRT812495	hsa-miR-642b	CLIP-seq
MIRT812496	hsa-miR-654-5p	CLIP-seq
MIRT812497	hsa-miR-661	CLIP-seq
MIRT812498	hsa-miR-766	CLIP-seq
MIRT812499	hsa-miR-767-5p	CLIP-seq
MIRT1545649	hsa-miR-3179	CLIP-seq
MIRT1545650	hsa-miR-4658	CLIP-seq
MIRT1555999	hsa-miR-1231	CLIP-seq
MIRT1556000	hsa-miR-1538	CLIP-seq
MIRT812455	hsa-miR-24	CLIP-seq
MIRT1556001	hsa-miR-3120-5p	CLIP-seq
MIRT1556002	hsa-miR-3126-5p	CLIP-seq
MIRT1556003	hsa-miR-3192	CLIP-seq
MIRT1556004	hsa-miR-3649	CLIP-seq
MIRT812463	hsa-miR-3689a-3p	CLIP-seq
MIRT812464	hsa-miR-3689c	CLIP-seq
MIRT812468	hsa-miR-4284	CLIP-seq
MIRT1556005	hsa-miR-4314	CLIP-seq
MIRT1556006	hsa-miR-4419a	CLIP-seq
MIRT1556007	hsa-miR-4510	CLIP-seq
MIRT1556008	hsa-miR-4646-5p	CLIP-seq
MIRT1556009	hsa-miR-4710	CLIP-seq
MIRT812480	hsa-miR-4728-5p	CLIP-seq
MIRT1556010	hsa-miR-4745-3p	CLIP-seq
MIRT1556011	hsa-miR-492	CLIP-seq
MIRT812449	hsa-miR-1228	CLIP-seq
MIRT812450	hsa-miR-1262	CLIP-seq
MIRT812452	hsa-miR-128	CLIP-seq
MIRT812453	hsa-miR-216a	CLIP-seq
MIRT812454	hsa-miR-216b	CLIP-seq
MIRT812455	hsa-miR-24	CLIP-seq
MIRT1940259	hsa-miR-25	CLIP-seq
MIRT812456	hsa-miR-3065-3p	CLIP-seq
MIRT812457	hsa-miR-3122	CLIP-seq
MIRT1940260	hsa-miR-3153	CLIP-seq
MIRT1940261	hsa-miR-32	CLIP-seq
MIRT812459	hsa-miR-329	CLIP-seq
MIRT812460	hsa-miR-3614-5p	CLIP-seq
MIRT812461	hsa-miR-362-3p	CLIP-seq
MIRT1940262	hsa-miR-363	CLIP-seq
MIRT1940263	hsa-miR-367	CLIP-seq
MIRT812462	hsa-miR-3672	CLIP-seq
MIRT812463	hsa-miR-3689a-3p	CLIP-seq
MIRT812464	hsa-miR-3689c	CLIP-seq
MIRT812465	hsa-miR-3913-5p	CLIP-seq
MIRT812467	hsa-miR-3929	CLIP-seq
MIRT812468	hsa-miR-4284	CLIP-seq
MIRT812469	hsa-miR-4419b	CLIP-seq
MIRT812470	hsa-miR-4433	CLIP-seq
MIRT812471	hsa-miR-4455	CLIP-seq
MIRT812472	hsa-miR-4459	CLIP-seq
MIRT812474	hsa-miR-4478	CLIP-seq
MIRT812478	hsa-miR-4701-3p	CLIP-seq
MIRT812480	hsa-miR-4728-5p	CLIP-seq
MIRT812481	hsa-miR-4768-3p	CLIP-seq
MIRT812483	hsa-miR-4793-3p	CLIP-seq
MIRT812484	hsa-miR-485-5p	CLIP-seq
MIRT812487	hsa-miR-508-5p	CLIP-seq
MIRT812493	hsa-miR-541	CLIP-seq
MIRT812495	hsa-miR-642b	CLIP-seq
MIRT812496	hsa-miR-654-5p	CLIP-seq
MIRT812497	hsa-miR-661	CLIP-seq
MIRT812498	hsa-miR-766	CLIP-seq
MIRT812499	hsa-miR-767-5p	CLIP-seq
MIRT1940264	hsa-miR-92a	CLIP-seq
MIRT1940265	hsa-miR-92b	CLIP-seq
MIRT812449	hsa-miR-1228	CLIP-seq
MIRT812450	hsa-miR-1262	CLIP-seq
MIRT812452	hsa-miR-128	CLIP-seq
MIRT812453	hsa-miR-216a	CLIP-seq
MIRT812454	hsa-miR-216b	CLIP-seq
MIRT2179175	hsa-miR-217	CLIP-seq
MIRT812455	hsa-miR-24	CLIP-seq
MIRT812456	hsa-miR-3065-3p	CLIP-seq
MIRT812457	hsa-miR-3122	CLIP-seq
MIRT812459	hsa-miR-329	CLIP-seq
MIRT812460	hsa-miR-3614-5p	CLIP-seq
MIRT812461	hsa-miR-362-3p	CLIP-seq
MIRT812462	hsa-miR-3672	CLIP-seq
MIRT812463	hsa-miR-3689a-3p	CLIP-seq
MIRT812464	hsa-miR-3689c	CLIP-seq
MIRT812465	hsa-miR-3913-5p	CLIP-seq
MIRT812466	hsa-miR-3919	CLIP-seq
MIRT812467	hsa-miR-3929	CLIP-seq
MIRT812468	hsa-miR-4284	CLIP-seq
MIRT2179176	hsa-miR-4418	CLIP-seq
MIRT812469	hsa-miR-4419b	CLIP-seq
MIRT812470	hsa-miR-4433	CLIP-seq
MIRT812471	hsa-miR-4455	CLIP-seq
MIRT812472	hsa-miR-4459	CLIP-seq
MIRT812474	hsa-miR-4478	CLIP-seq
MIRT812478	hsa-miR-4701-3p	CLIP-seq
MIRT812480	hsa-miR-4728-5p	CLIP-seq
MIRT812481	hsa-miR-4768-3p	CLIP-seq
MIRT812483	hsa-miR-4793-3p	CLIP-seq
MIRT812484	hsa-miR-485-5p	CLIP-seq
MIRT812487	hsa-miR-508-5p	CLIP-seq
MIRT2179177	hsa-miR-509-3-5p	CLIP-seq
MIRT2179178	hsa-miR-509-5p	CLIP-seq
MIRT812493	hsa-miR-541	CLIP-seq
MIRT812495	hsa-miR-642b	CLIP-seq
MIRT812496	hsa-miR-654-5p	CLIP-seq
MIRT812497	hsa-miR-661	CLIP-seq
MIRT812498	hsa-miR-766	CLIP-seq
MIRT2384665	hsa-miR-196a	CLIP-seq
MIRT2384666	hsa-miR-196b	CLIP-seq
MIRT812453	hsa-miR-216a	CLIP-seq
MIRT812454	hsa-miR-216b	CLIP-seq
MIRT2384667	hsa-miR-2276	CLIP-seq
MIRT812455	hsa-miR-24	CLIP-seq
MIRT1940259	hsa-miR-25	CLIP-seq
MIRT812456	hsa-miR-3065-3p	CLIP-seq
MIRT812457	hsa-miR-3122	CLIP-seq
MIRT1940260	hsa-miR-3153	CLIP-seq
MIRT1940261	hsa-miR-32	CLIP-seq
MIRT2384668	hsa-miR-342-5p	CLIP-seq
MIRT2384669	hsa-miR-34b	CLIP-seq
MIRT2384670	hsa-miR-3545-3p	CLIP-seq
MIRT812460	hsa-miR-3614-5p	CLIP-seq
MIRT1940262	hsa-miR-363	CLIP-seq
MIRT1940263	hsa-miR-367	CLIP-seq
MIRT812463	hsa-miR-3689a-3p	CLIP-seq
MIRT812464	hsa-miR-3689c	CLIP-seq
MIRT812465	hsa-miR-3913-5p	CLIP-seq
MIRT2384671	hsa-miR-3927	CLIP-seq
MIRT812467	hsa-miR-3929	CLIP-seq
MIRT812468	hsa-miR-4284	CLIP-seq
MIRT1556006	hsa-miR-4419a	CLIP-seq
MIRT812469	hsa-miR-4419b	CLIP-seq
MIRT2384672	hsa-miR-4446-3p	CLIP-seq
MIRT2384673	hsa-miR-4450	CLIP-seq
MIRT2384674	hsa-miR-4476	CLIP-seq
MIRT812474	hsa-miR-4478	CLIP-seq
MIRT1556007	hsa-miR-4510	CLIP-seq
MIRT2384675	hsa-miR-4651	CLIP-seq
MIRT2384676	hsa-miR-4654	CLIP-seq
MIRT2384677	hsa-miR-4664-5p	CLIP-seq
MIRT2384678	hsa-miR-4668-5p	CLIP-seq
MIRT812477	hsa-miR-4680-5p	CLIP-seq
MIRT812480	hsa-miR-4728-5p	CLIP-seq
MIRT2384679	hsa-miR-4747-5p	CLIP-seq
MIRT2384680	hsa-miR-4769-5p	CLIP-seq
MIRT2384681	hsa-miR-4796-3p	CLIP-seq
MIRT812484	hsa-miR-485-5p	CLIP-seq
MIRT2384682	hsa-miR-491-5p	CLIP-seq
MIRT812486	hsa-miR-493	CLIP-seq
MIRT2384683	hsa-miR-524-3p	CLIP-seq
MIRT2384684	hsa-miR-525-3p	CLIP-seq
MIRT812493	hsa-miR-541	CLIP-seq
MIRT2384685	hsa-miR-608	CLIP-seq
MIRT812496	hsa-miR-654-5p	CLIP-seq
MIRT2384686	hsa-miR-7	CLIP-seq
MIRT1940264	hsa-miR-92a	CLIP-seq
MIRT1940265	hsa-miR-92b	CLIP-seq
MIRT2426567	hsa-miR-139-5p	CLIP-seq
MIRT2426568	hsa-miR-144	CLIP-seq
MIRT2384665	hsa-miR-196a	CLIP-seq
MIRT2384666	hsa-miR-196b	CLIP-seq
MIRT2426569	hsa-miR-203	CLIP-seq
MIRT2384667	hsa-miR-2276	CLIP-seq
MIRT2426570	hsa-miR-296-3p	CLIP-seq
MIRT1940260	hsa-miR-3153	CLIP-seq
MIRT2384668	hsa-miR-342-5p	CLIP-seq
MIRT2384671	hsa-miR-3927	CLIP-seq
MIRT2384672	hsa-miR-4446-3p	CLIP-seq
MIRT2384673	hsa-miR-4450	CLIP-seq
MIRT2384674	hsa-miR-4476	CLIP-seq
MIRT2384675	hsa-miR-4651	CLIP-seq
MIRT2384677	hsa-miR-4664-5p	CLIP-seq
MIRT2384678	hsa-miR-4668-5p	CLIP-seq
MIRT2426571	hsa-miR-4773	CLIP-seq
MIRT2384682	hsa-miR-491-5p	CLIP-seq
MIRT2384683	hsa-miR-524-3p	CLIP-seq
MIRT2384684	hsa-miR-525-3p	CLIP-seq
MIRT2384685	hsa-miR-608	CLIP-seq
MIRT2426572	hsa-miR-627	CLIP-seq
MIRT2384686	hsa-miR-7	CLIP-seq
MIRT2426573	hsa-miR-924	CLIP-seq
MIRT1940259	hsa-miR-25	CLIP-seq
MIRT1940261	hsa-miR-32	CLIP-seq
MIRT1940262	hsa-miR-363	CLIP-seq
MIRT1940263	hsa-miR-367	CLIP-seq
MIRT1940264	hsa-miR-92a	CLIP-seq
MIRT1940265	hsa-miR-92b	CLIP-seq
MIRT2444532	hsa-miR-10a	CLIP-seq
MIRT2444533	hsa-miR-10b	CLIP-seq
MIRT812471	hsa-miR-4455	CLIP-seq
MIRT2444534	hsa-miR-4661-3p	CLIP-seq
MIRT2444535	hsa-miR-593	CLIP-seq
MIRT2444536	hsa-miR-651	CLIP-seq
MIRT2444532	hsa-miR-10a	CLIP-seq
MIRT2444533	hsa-miR-10b	CLIP-seq
MIRT812452	hsa-miR-128	CLIP-seq
MIRT1556000	hsa-miR-1538	CLIP-seq
MIRT2426569	hsa-miR-203	CLIP-seq
MIRT2482629	hsa-miR-2110	CLIP-seq
MIRT812453	hsa-miR-216a	CLIP-seq
MIRT812454	hsa-miR-216b	CLIP-seq
MIRT2482630	hsa-miR-219-2-3p	CLIP-seq
MIRT812455	hsa-miR-24	CLIP-seq
MIRT1940259	hsa-miR-25	CLIP-seq
MIRT2482631	hsa-miR-2964a-3p	CLIP-seq
MIRT2482632	hsa-miR-300	CLIP-seq
MIRT812456	hsa-miR-3065-3p	CLIP-seq
MIRT812457	hsa-miR-3122	CLIP-seq
MIRT812458	hsa-miR-3123	CLIP-seq
MIRT2482633	hsa-miR-3138	CLIP-seq
MIRT2482634	hsa-miR-3150a-3p	CLIP-seq
MIRT1940260	hsa-miR-3153	CLIP-seq
MIRT2482635	hsa-miR-3173-3p	CLIP-seq
MIRT2482636	hsa-miR-3175	CLIP-seq
MIRT2482637	hsa-miR-3184	CLIP-seq
MIRT1940261	hsa-miR-32	CLIP-seq
MIRT2482638	hsa-miR-324-5p	CLIP-seq
MIRT2482639	hsa-miR-331-3p	CLIP-seq
MIRT2482640	hsa-miR-3612	CLIP-seq
MIRT2482641	hsa-miR-3613-3p	CLIP-seq
MIRT812460	hsa-miR-3614-5p	CLIP-seq
MIRT1940262	hsa-miR-363	CLIP-seq
MIRT2482642	hsa-miR-3653	CLIP-seq
MIRT1940263	hsa-miR-367	CLIP-seq
MIRT812462	hsa-miR-3672	CLIP-seq
MIRT2482643	hsa-miR-3678-3p	CLIP-seq
MIRT2482644	hsa-miR-3684	CLIP-seq
MIRT812463	hsa-miR-3689a-3p	CLIP-seq
MIRT812464	hsa-miR-3689c	CLIP-seq
MIRT2482645	hsa-miR-381	CLIP-seq
MIRT2482646	hsa-miR-3908	CLIP-seq
MIRT812465	hsa-miR-3913-5p	CLIP-seq
MIRT2482647	hsa-miR-3926	CLIP-seq
MIRT812467	hsa-miR-3929	CLIP-seq
MIRT2482648	hsa-miR-423-5p	CLIP-seq
MIRT2482649	hsa-miR-4259	CLIP-seq
MIRT812468	hsa-miR-4284	CLIP-seq
MIRT2482650	hsa-miR-4305	CLIP-seq
MIRT2482651	hsa-miR-432	CLIP-seq
MIRT812469	hsa-miR-4419b	CLIP-seq
MIRT2482652	hsa-miR-4428	CLIP-seq
MIRT812470	hsa-miR-4433	CLIP-seq
MIRT2482653	hsa-miR-4452	CLIP-seq
MIRT812471	hsa-miR-4455	CLIP-seq
MIRT812472	hsa-miR-4459	CLIP-seq
MIRT812474	hsa-miR-4478	CLIP-seq
MIRT2482654	hsa-miR-4535	CLIP-seq
MIRT2444534	hsa-miR-4661-3p	CLIP-seq
MIRT2482655	hsa-miR-4666-3p	CLIP-seq
MIRT812477	hsa-miR-4680-5p	CLIP-seq
MIRT2482656	hsa-miR-4683	CLIP-seq
MIRT2482657	hsa-miR-4688	CLIP-seq
MIRT2482658	hsa-miR-4695-5p	CLIP-seq
MIRT812480	hsa-miR-4728-5p	CLIP-seq
MIRT2482659	hsa-miR-4734	CLIP-seq
MIRT1556010	hsa-miR-4745-3p	CLIP-seq
MIRT812481	hsa-miR-4768-3p	CLIP-seq
MIRT2426571	hsa-miR-4773	CLIP-seq
MIRT2482660	hsa-miR-4777-5p	CLIP-seq
MIRT2482661	hsa-miR-4789-5p	CLIP-seq
MIRT2482662	hsa-miR-4800-5p	CLIP-seq
MIRT812484	hsa-miR-485-5p	CLIP-seq
MIRT812485	hsa-miR-487a	CLIP-seq
MIRT1556011	hsa-miR-492	CLIP-seq
MIRT2482663	hsa-miR-494	CLIP-seq
MIRT812488	hsa-miR-518d-5p	CLIP-seq
MIRT812489	hsa-miR-519b-5p	CLIP-seq
MIRT812490	hsa-miR-519c-5p	CLIP-seq
MIRT812491	hsa-miR-520c-5p	CLIP-seq
MIRT812492	hsa-miR-526a	CLIP-seq
MIRT812493	hsa-miR-541	CLIP-seq
MIRT2482664	hsa-miR-548s	CLIP-seq
MIRT2482665	hsa-miR-551a	CLIP-seq
MIRT2482666	hsa-miR-551b	CLIP-seq
MIRT2444535	hsa-miR-593	CLIP-seq
MIRT2482667	hsa-miR-633	CLIP-seq
MIRT812495	hsa-miR-642b	CLIP-seq
MIRT2482668	hsa-miR-650	CLIP-seq
MIRT2444536	hsa-miR-651	CLIP-seq
MIRT812496	hsa-miR-654-5p	CLIP-seq
MIRT2482669	hsa-miR-765	CLIP-seq
MIRT1940264	hsa-miR-92a	CLIP-seq
MIRT1940265	hsa-miR-92b	CLIP-seq
MIRT2482670	hsa-miR-939	CLIP-seq
MIRT812455	hsa-miR-24	CLIP-seq
MIRT2482671	hsa-miR-3714	CLIP-seq
MIRT1556006	hsa-miR-4419a	CLIP-seq
MIRT1556007	hsa-miR-4510	CLIP-seq
MIRT2482672	hsa-miR-940	CLIP-seq
MIRT2675793	hsa-miR-101	CLIP-seq
MIRT2444532	hsa-miR-10a	CLIP-seq
MIRT2444533	hsa-miR-10b	CLIP-seq
MIRT812452	hsa-miR-128	CLIP-seq
MIRT2426567	hsa-miR-139-5p	CLIP-seq
MIRT2426568	hsa-miR-144	CLIP-seq
MIRT2675794	hsa-miR-151-3p	CLIP-seq
MIRT2675795	hsa-miR-186	CLIP-seq
MIRT2426569	hsa-miR-203	CLIP-seq
MIRT2482629	hsa-miR-2110	CLIP-seq
MIRT812453	hsa-miR-216a	CLIP-seq
MIRT812454	hsa-miR-216b	CLIP-seq
MIRT2482630	hsa-miR-219-2-3p	CLIP-seq
MIRT812455	hsa-miR-24	CLIP-seq
MIRT1940259	hsa-miR-25	CLIP-seq
MIRT2426570	hsa-miR-296-3p	CLIP-seq
MIRT2482631	hsa-miR-2964a-3p	CLIP-seq
MIRT2482632	hsa-miR-300	CLIP-seq
MIRT812456	hsa-miR-3065-3p	CLIP-seq
MIRT812457	hsa-miR-3122	CLIP-seq
MIRT812458	hsa-miR-3123	CLIP-seq
MIRT2482634	hsa-miR-3150a-3p	CLIP-seq
MIRT2482636	hsa-miR-3175	CLIP-seq
MIRT2482637	hsa-miR-3184	CLIP-seq
MIRT1940261	hsa-miR-32	CLIP-seq
MIRT2482641	hsa-miR-3613-3p	CLIP-seq
MIRT812460	hsa-miR-3614-5p	CLIP-seq
MIRT1940262	hsa-miR-363	CLIP-seq
MIRT2482642	hsa-miR-3653	CLIP-seq
MIRT1940263	hsa-miR-367	CLIP-seq
MIRT812462	hsa-miR-3672	CLIP-seq
MIRT2482643	hsa-miR-3678-3p	CLIP-seq
MIRT2482644	hsa-miR-3684	CLIP-seq
MIRT812463	hsa-miR-3689a-3p	CLIP-seq
MIRT812464	hsa-miR-3689c	CLIP-seq
MIRT2482645	hsa-miR-381	CLIP-seq
MIRT2482646	hsa-miR-3908	CLIP-seq
MIRT812465	hsa-miR-3913-5p	CLIP-seq
MIRT2482647	hsa-miR-3926	CLIP-seq
MIRT812467	hsa-miR-3929	CLIP-seq
MIRT2482648	hsa-miR-423-5p	CLIP-seq
MIRT2482649	hsa-miR-4259	CLIP-seq
MIRT812468	hsa-miR-4284	CLIP-seq
MIRT2482650	hsa-miR-4305	CLIP-seq
MIRT2482651	hsa-miR-432	CLIP-seq
MIRT812469	hsa-miR-4419b	CLIP-seq
MIRT2482652	hsa-miR-4428	CLIP-seq
MIRT812470	hsa-miR-4433	CLIP-seq
MIRT2482653	hsa-miR-4452	CLIP-seq
MIRT812471	hsa-miR-4455	CLIP-seq
MIRT812472	hsa-miR-4459	CLIP-seq
MIRT812474	hsa-miR-4478	CLIP-seq
MIRT2444534	hsa-miR-4661-3p	CLIP-seq
MIRT2482655	hsa-miR-4666-3p	CLIP-seq
MIRT2482657	hsa-miR-4688	CLIP-seq
MIRT812480	hsa-miR-4728-5p	CLIP-seq
MIRT812481	hsa-miR-4768-3p	CLIP-seq
MIRT2426571	hsa-miR-4773	CLIP-seq
MIRT2482660	hsa-miR-4777-5p	CLIP-seq
MIRT2482661	hsa-miR-4789-5p	CLIP-seq
MIRT812484	hsa-miR-485-5p	CLIP-seq
MIRT812485	hsa-miR-487a	CLIP-seq
MIRT2482663	hsa-miR-494	CLIP-seq
MIRT812488	hsa-miR-518d-5p	CLIP-seq
MIRT812489	hsa-miR-519b-5p	CLIP-seq
MIRT812490	hsa-miR-519c-5p	CLIP-seq
MIRT812491	hsa-miR-520c-5p	CLIP-seq
MIRT812492	hsa-miR-526a	CLIP-seq
MIRT812493	hsa-miR-541	CLIP-seq
MIRT2482664	hsa-miR-548s	CLIP-seq
MIRT2482665	hsa-miR-551a	CLIP-seq
MIRT2482666	hsa-miR-551b	CLIP-seq
MIRT2444535	hsa-miR-593	CLIP-seq
MIRT2482667	hsa-miR-633	CLIP-seq
MIRT812495	hsa-miR-642b	CLIP-seq
MIRT2444536	hsa-miR-651	CLIP-seq
MIRT812496	hsa-miR-654-5p	CLIP-seq
MIRT2482669	hsa-miR-765	CLIP-seq
MIRT1940264	hsa-miR-92a	CLIP-seq
MIRT1940265	hsa-miR-92b	CLIP-seq
MIRT2482670	hsa-miR-939	CLIP-seq
MIRT1940259	hsa-miR-25	CLIP-seq
MIRT1940261	hsa-miR-32	CLIP-seq
MIRT1940262	hsa-miR-363	CLIP-seq
MIRT1940263	hsa-miR-367	CLIP-seq
MIRT1940264	hsa-miR-92a	CLIP-seq
MIRT1940265	hsa-miR-92b	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
EZH2	Activation	23077658

Show/Hide all (84)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0001618	Function	Virus receptor activity	IDA	22156524
GO:0001618	Function	Virus receptor activity	IEA
GO:0001764	Process	Neuron migration	IEA
GO:0001779	Process	Natural killer cell differentiation	IBA
GO:0001779	Process	Natural killer cell differentiation	IEA
GO:0001786	Function	Phosphatidylserine binding	IDA	21501828
GO:0001818	Process	Negative regulation of cytokine production	IEA
GO:0001818	Process	Negative regulation of cytokine production	IEA
GO:0001961	Process	Positive regulation of cytokine-mediated signaling pathway	IDA	18840707
GO:0001974	Process	Blood vessel remodeling	IEA
GO:0002376	Process	Immune system process	IEA
GO:0004672	Function	Protein kinase activity	IEA
GO:0004713	Function	Protein tyrosine kinase activity	EXP	22327215
GO:0004713	Function	Protein tyrosine kinase activity	IEA
GO:0004714	Function	Transmembrane receptor protein tyrosine kinase activity	IBA
GO:0004714	Function	Transmembrane receptor protein tyrosine kinase activity	IEA
GO:0004714	Function	Transmembrane receptor protein tyrosine kinase activity	TAS	1656220
GO:0005515	Function	Protein binding	IPI	7854420, 9178760, 16362042, 18760998, 20088931, 22939624, 25873175, 31980649, 33420426, 35384245, 35512704
GO:0005524	Function	ATP binding	IEA
GO:0005615	Component	Extracellular space	IDA	20088931
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	1656220
GO:0006909	Process	Phagocytosis	IBA
GO:0006909	Process	Phagocytosis	IDA	21501828
GO:0006909	Process	Phagocytosis	IEA
GO:0006909	Process	Phagocytosis	IEA
GO:0006915	Process	Apoptotic process	IEA
GO:0006954	Process	Inflammatory response	IEA
GO:0007165	Process	Signal transduction	TAS	1656220
GO:0007167	Process	Enzyme-linked receptor protein signaling pathway	IEA
GO:0007167	Process	Enzyme-linked receptor protein signaling pathway	IEA
GO:0007169	Process	Cell surface receptor protein tyrosine kinase signaling pathway	IBA
GO:0007283	Process	Spermatogenesis	IEA
GO:0007399	Process	Nervous system development	IBA
GO:0009967	Process	Positive regulation of signal transduction	IEA
GO:0009986	Component	Cell surface	HDA	19581412
GO:0009986	Component	Cell surface	IDA	19657094, 21529875
GO:0010936	Process	Negative regulation of macrophage cytokine production	IEA
GO:0015629	Component	Actin cytoskeleton	IDA
GO:0016020	Component	Membrane	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016477	Process	Cell migration	IBA
GO:0016740	Function	Transferase activity	IEA
GO:0021885	Process	Forebrain cell migration	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0030168	Process	Platelet activation	IBA
GO:0030168	Process	Platelet activation	IEA
GO:0032689	Process	Negative regulation of type II interferon production	IDA	18840707
GO:0032720	Process	Negative regulation of tumor necrosis factor production	IEA
GO:0032825	Process	Positive regulation of natural killer cell differentiation	IDA	18840707
GO:0032940	Process	Secretion by cell	IEA
GO:0034101	Process	Erythrocyte homeostasis	IEA
GO:0034446	Process	Substrate adhesion-dependent cell spreading	IEA
GO:0035457	Process	Cellular response to interferon-alpha	IDA	19657094
GO:0042698	Process	Ovulation cycle	IEA
GO:0043066	Process	Negative regulation of apoptotic process	IBA
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0043235	Component	Receptor complex	IBA
GO:0043277	Process	Apoptotic cell clearance	IEA
GO:0043524	Process	Negative regulation of neuron apoptotic process	IEA
GO:0045087	Process	Innate immune response	IEA
GO:0046649	Process	Lymphocyte activation	IEA
GO:0046718	Process	Symbiont entry into host cell	IMP	21047970
GO:0048010	Process	Vascular endothelial growth factor receptor signaling pathway	TAS
GO:0048469	Process	Cell maturation	IEP	19657094
GO:0048549	Process	Positive regulation of pinocytosis	IMP	21047970
GO:0051249	Process	Regulation of lymphocyte activation	IEA
GO:0051250	Process	Negative regulation of lymphocyte activation	IEA
GO:0051402	Process	Neuron apoptotic process	IEA
GO:0051649	Process	Establishment of localization in cell	IEA
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IBA
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IEA
GO:0060068	Process	Vagina development	IEA
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:0071222	Process	Cellular response to lipopolysaccharide	IDA	19657094
GO:0097028	Process	Dendritic cell differentiation	IEP	19657094
GO:0097350	Process	Neutrophil clearance	IEA
GO:1903131	Process	Mononuclear cell differentiation	IEA
GO:1903902	Process	Positive regulation of viral life cycle	IMP	22673088
GO:2000669	Process	Negative regulation of dendritic cell apoptotic process	IDA	19657094

MIM	HGNC	e!Ensembl
109135	905	ENSG00000167601

P30530

Protein name

Tyrosine-protein kinase receptor UFO (EC 2.7.10.1) (AXL oncogene)

Protein function

Receptor tyrosine kinase that transduces signals from the extracellular matrix into the cytoplasm by binding growth factor GAS6 and which is thus regulating many physiological processes including cell survival, cell proliferation, migration and

PDB

2C5D , 4RA0 , 5U6B , 5VXZ

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13927	Ig_3	37 → 120		Domain
PF00041	fn3	226 → 321	Fibronectin type III domain	Domain
PF00041	fn3	335 → 418	Fibronectin type III domain	Domain
PF07714	PK_Tyr_Ser-Thr	536 → 803	Protein tyrosine and serine/threonine kinase	Domain

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in metastatic colon tumors. Expressed in primary colon tumors. Weakly expressed in normal colon tissue. {ECO:0000269|PubMed:7896447}.

Sequence

MAWRCPRMGRVPLAWCLALCGWACMAPRGTQAEESPFVGNPGNITGARGLTGTLRCQLQV
QGEPPEVHWLRDGQILELADSTQTQVPLGEDEQDDWIVVSQLRITSLQLSDTGQYQCLVF
LGHQTFVSQPGYVGLEGLPYFLEEPEDRTVAANTPFNLSCQAQGPPEPVDLLWLQDAVPL
ATAPGHGPQRSLHVPGLNKTSSFSCEAHNAKGVTTSRTATITVLPQQPRNLHLVSRQPTE
LEVAWTPGLSGIYPLTHCTLQAVLSDDGMGIQAGEPDPPEEPLTSQASVPPHQLRLGSLH
PHTPYHIRVACTSSQGPSSWTHWLPVETPEGVPLGPPENISATRNGSQAFVHWQEPRAPL
QGTLLGYRLAYQGQDTPEVLMDIGLRQEVTLELQGDGSVSNLTVCVAAYTAAGDGPWSLP
VPLEAWRPGQAQPVHQLVKEPSTPAFSWPWWYVLLGAVVAAACVLILALFLVHRRKKETR
YGEVFEPTVERGELVVRYRVRKSYSRRTTEATLNSLGISEELKEKLRDVMVDRHKVALGK
TLGEGEFGAVMEGQLNQDDSILKVAVKTMKIAICTRSELEDFLSEAVCMKEFDHPNVMRL
IGVCFQGSERESFPAPVVILPFMKHGDLHSFLLYSRLGDQPVYLPTQMLVKFMADIASGM
EYLSTKRFIHRDLAARNCMLNENMSVCVADFGLSKKIYNGDYYRQGRIAKMPVKWIAIES
LADRVYTSKSDVWSFGVTMWEIATRGQTPYPGVENSEIYDYLRQGNRLKQPADCLDGLYA
LMSRCWELNPQDRPSFTELREDLENTLKALPPAQEPDEILYVNMDEGGGYPEPPGAAGGA
DPPTQPDPKDSCSCLTAAEVHPAGRYVLCPSTTPSPAQPADRGSPAAPGQEDGA

Sequence length

894

Interactions

View interactions

	KEGG		Reactome
	EGFR tyrosine kinase inhibitor resistance Efferocytosis		VEGFA-VEGFR2 Pathway

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
NK-cell enteropathy	Likely pathogenic	rs1599744167	RCV000791317	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (26)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Amenorrhea	Uncertain significance; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AXL-related disorder	Conflicting classifications of pathogenicity; Uncertain significance; Likely benign; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, NON-SMALL-CELL LUNG	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, NON-INSULIN-DEPENDENT	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC NEPHROPATHIES	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC NEPHROPATHY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Uncertain significance; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOGONADOTROPIC HYPOGONADISM	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypogonadotropic hypogonadism 7 with or without anosmia	Benign; Likely benign	ClinVar ClinVar, HPO ClinVar, HPO	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
HYPOPITUITARISM	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IDIOPATHIC GROWTH HORMONE DEFICIENCY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IDIOPATHIC HYPOGONADOTROPIC HYPOGONADISM	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KALLMANN SYNDROME	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant lymphoma, large B-cell, diffuse	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PANCREATIC NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PANHYPOPITUITARISM	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PITUITARY DWARFISM	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PITUITARY SHORT STATURE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SHEEHAN SYNDROME	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (241)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma	Adenocarcinoma	LHGDN	16354588		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	30744655		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma Of Esophagus	Esophageal Cancer	BEFREE	20818175, 23117882, 23479507, 30189359, 30353671		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	26475093, 26942465, 27100677, 30501603, 30744655, 31703465		★★★★★ ★☆☆☆☆ Found in Text Mining only
Allergic sensitization	Allergic Sensitization	BEFREE	30082152		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	35229272	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia Hemolytic	Hemolytic anemia	Pubtator	23361052	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	24240689, 29180468		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anophthalmia with pulmonary hypoplasia	Anophthalmia	Pubtator	37530334	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	28639625, 30508140		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	10233855	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	24659691, 30029617, 9817738		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	29177020, 30029617	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	20423999, 29379210		★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	20423999	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	22907951, 32849633	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	19059436		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	28727830	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Azoospermia, Nonobstructive	Azoospermia	BEFREE	24762434		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	21822309, 26225770		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	16585512, 26257061		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	28551766	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	18339872, 21317930, 21814748, 22052326, 27829217, 28596680, 29719259		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	21814748, 22052326, 22945653, 24904064, 25332238, 25809865, 26760782, 27081041, 32174798, 32681075, 33374832, 33785524, 35594351, 38132919	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	27629742	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	39527598	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms Male	Male breast neoplasms	Pubtator	27987320	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Calcinosis	Calcinosis	Pubtator	16556867	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	20423999, 21796150, 23527720, 28492542, 28720772, 31729427, 37530334	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	Pubtator	26847678, 38369783	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	27466525, 28986088		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Adenoid Cystic	Adenoid cystic carcinoma	Pubtator	33172898	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal	Ductal carcinoma	Pubtator	22052326	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	24304619, 24347489, 25251599, 27182739, 27765911, 28526812, 30765873, 31094090, 31917795, 32138467, 32755597, 37433225	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Large Cell	Large cell carcinoma	Pubtator	33172976	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	21822309, 26225770		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	11677117, 16354588, 22751098, 24165158, 25780909, 27825638, 28260071, 29136529, 29433983, 29930762, 30542697, 31431614, 31488404		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of Male Breast	Breast Carcinoma, male	BEFREE	27987320		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	26356564	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	20922806, 31959629, 32909687, 37530334	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	19567592, 19888345, 22806541, 25187556, 26287733, 28492542, 28596300, 28986088, 31269715, 34407968, 34611307	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	16641895	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	21068757	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	25895459, 27466525, 29246304, 30478151, 31262907		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Dilated	Cardiomyopathy	BEFREE	8381058		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	22052326		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carotid Atherosclerosis	Carotid Atherosclerosis	BEFREE	20664904		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	BEFREE	30004959		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	20664904		★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	28720772, 29334371		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	28720772, 29334371		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood asthma	Asthma	BEFREE	30029617		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	34697068, 35478117	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	Pubtator	28727830	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	28596680		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	33570712, 39333335	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	28727830, 29789423		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	23372686, 25193853, 33570712, 33759958, 34669880, 36409270, 38263746	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	28727830	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	31181097, 8293560, 8381058		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	14565870, 22806541, 26364599, 28492542, 28986088, 29309249, 30372397, 31184937, 31501521, 31585940		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	28829817	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Disease	Coronary artery disease	Pubtator	26924277	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	28369510		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	32676663	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cryptorchidism	Cryptorchidism	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Demyelinating Diseases	Demyelinating diseases	Pubtator	21347448	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	24572151	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	37813528	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Angiopathies	Diabetic angiopathies	Pubtator	24572151	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	CTD_human_DG	12644472		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	27764792		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Hyperplasia	Endometrial hyperplasia	Pubtator	28951454	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	12796028, 35588308, 36965901	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	LHGDN	19055724		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	19055724	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	23117882		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	23117882, 25568334		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	23117882, 32432570	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	27172793	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	25528764		★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial multiple trichoepitheliomata	Multiple Trichoepithelioma	BEFREE	23117882, 23479507, 30189359, 30353671		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	25218593		★★★★★ ★☆☆☆☆ Found in Text Mining only
gallbladder neoplasm	Neoplasm of gallbladder	BEFREE	25218593		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	BEFREE	21171987, 25557174, 30488756		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	Pubtator	30488756	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma, Primary Open Angle	Glaucoma	BEFREE	29253013		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	12218057, 25980499, 28208648, 28604685, 30108175, 35055167, 40725039	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	23077658, 25921812, 28208648, 28356518, 28881571, 29531161, 29660005, 30108175, 31578804		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	23077658, 25921812, 25980499, 28208648, 28356518, 28881571, 29531161, 29660005, 30108175, 31578804, 31824472		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	16585512, 29843637, 31240814, 31578804		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	LHGDN	16585512, 18172262		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	23077658, 25980499, 28790340, 31240814	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glycosuria Renal	Renal glycosuria	Pubtator	27211902	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gynecomastia	Gynecomastia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	28476872		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	28025482, 28476872, 35461210, 36753744	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	24572151	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	24681018	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	31181097, 8293560, 8381058		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	31075180	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	31694201		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematopoietic Neoplasms	Hematopoietic Neoplasms	BEFREE	31075180		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis B Chronic	Hepatitis b	Pubtator	32138467	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypogonadotropic hypogonadism	Hypogonadotropic Hypogonadism	BEFREE	24476074		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypogonadotropic hypogonadism	Hypogonadotropic Hypogonadism	HPO_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypoxia	Hypoxia	Pubtator	22516347, 25187556, 35055167, 36753617	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	30923103	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic hypogonadotropic hypogonadism	Hypogonadotropic Hypogonadism	BEFREE	24476074		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Idiopathic Hypogonadotropic Hypogonadism	Hypogonadotropic hypogonadism	Pubtator	33208564	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Idiopathic hypogonadotropic hypogonadism	Hypogonadotropic Hypogonadism	CTD_human_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Intestinal Diseases	Intestinal disease	Pubtator	32676663	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic cardiomyopathy	Ischemic myocardial dysfunction	BEFREE	8381058		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kallmann Syndrome	Kallmann Syndrome	BEFREE	24476074		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	20442363		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasm	Kidney Neoplasm	CTD_human_DG	25551830		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	31917795	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LATERAL MENINGOCELE SYNDROME	Lateral Meningocele Syndrome	BEFREE	29024938		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leiomyosarcoma	Leiomyosarcoma	Pubtator	23334251, 29024938	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
leiomyosarcoma	Leiomyosarcoma	BEFREE	23354874, 29024938		★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	20977427, 23117882, 8656672, 9130617		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	21135257, 34103328, 36835239	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Lymphoid	Lymphoid leukemia	Pubtator	7521695	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	23321254, 26172401, 30923103, 7521695	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	18502572, 28289089, 28516360, 28881658, 30039554, 30340900, 30559267, 30936061, 31694201		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukocyte adhesion deficiency type 1	Leukocyte adhesion deficiency	BEFREE	26942465, 27100677		★★★★★ ★☆☆☆☆ Found in Text Mining only
LIMB-MAMMARY SYNDROME	Limb-Mammary Syndrome	BEFREE	29024938		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liposarcoma	Liposarcoma	Pubtator	26573603	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liposarcoma Myxoid	Liposarcoma	Pubtator	23401071	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	21076472, 24347489, 30567378		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	16354588, 26667302, 29136529, 30744655, 31999390, 33207077, 35022314, 35643725, 36224313, 37834326, 38342232	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	31729427		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	27211902	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	27237127		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus nephritis	Pubtator	27211902	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	28127639		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	19252414, 24347489, 31917795, 35332208	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	35478117, 37530334	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoid leukemia	Lymphoid leukemia	BEFREE	31694201		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	8656672		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	28476872		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	18339872, 21317930, 21814748, 22052326, 27829217, 28596680, 29719259, 31007848		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	27764792		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	23117882		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	25218593		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	CTD_human_DG	25551830		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	28289089		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	11677117, 16354588, 22751098, 24165158, 25780909, 27825638, 28260071, 29136529, 29433983, 29930762, 30053332, 30542697, 30651547, 30744655, 31431614, 31488404 View all (1 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	25895459, 27466525, 29246304, 30478151, 31262907		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	19252414, 24240689, 26206560, 27629742, 29496493, 30936462		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	CTD_human_DG	26206560		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	10403904, 15492251, 22410775, 28072762, 28455956, 30291220, 31269290		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	12168903, 28454330		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	21822309, 26225770		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	20145042, 20423999, 20977427, 21317930, 21555911, 23320102, 23921085, 25482942, 25568918, 25596315, 26763248, 26951083, 27629742, 27671334, 27852702 View all (31 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	28720772, 29334371		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	28596680		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	14729616		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Melanoma	Pubtator	21521745, 21796150, 22071539, 23617806, 24950457, 27102439, 27502397, 27927748, 30953519, 31917795, 35332208, 36251678, 36753617	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
melanoma	Melanoma	BEFREE	23617806, 25502142, 27927748, 28606996, 29334371, 29551771, 29563139, 29995873		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma Cutaneous Malignant	Melanoma	Pubtator	21796150, 33082316	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	39179860	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	21132014, 29375377		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	Pubtator	24762959	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	23361052, 31752449	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	BEFREE	28103611		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	31075180, 35967396	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	31694201		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	19541935	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	21347448, 30114292		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	21347448	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	23320102		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia	Myeloid Leukemia	BEFREE	8656672		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	25965880, 27852702, 27856601		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloproliferative Disorders	Myeloproliferative disorder	Pubtator	7521695	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
MYELOPROLIFERATIVE SYNDROME, TRANSIENT	Myeloproliferative disorder	BEFREE	28251492		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	27629742	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	16641895, 19567592, 20442363, 21822309, 22410775, 22751098, 22806541, 23117882, 23982172, 24240689, 25136066, 25482942, 25528764, 25767293, 26206560 View all (36 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephritis	Nephritis	BEFREE	29895432		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neural Tube Defects	Neural tube defect	Pubtator	7521695	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurilemmoma	Neurilemmoma	BEFREE	23318455		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurilemmoma	Neurilemmoma	CTD_human_DG	25551830		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	23523856, 25450694, 25596315, 26616860		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	26616860, 28468579	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 1	Neurofibromatosis	Pubtator	31917795	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurofibrosarcoma	Neurofibrosarcoma	Pubtator	32193699	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nodular glomerulosclerosis	Glomerulosclerosis	CTD_human_DG	12644472		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	21317930, 23972815, 24165158, 25136066, 25760142, 26475093, 28049763, 28260071, 28352985, 28551766, 28673000, 29050231, 29136529, 29259259, 29277784 View all (13 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	CTD_human_DG	22751098		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	34841689	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis Knee	Osteoarthritis	Pubtator	34841689	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	40660573	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	23527720		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	23527720, 31836741	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	31262907		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	20858715, 25895459, 27466525, 29246304, 30478151		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	18283315, 25895459, 26356564, 28407786, 32385243, 37349576	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	32291856	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	19252414, 24240689, 26206560, 27629742, 30936462		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	20922806		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	CTD_human_DG	26206560		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	19252414, 23872419, 29157747, 30419905, 31959629, 35993361	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Patent ductus arteriosus	Patent ductus arteriosus	BEFREE	20922806		★★★★★ ★☆☆☆☆ Found in Text Mining only
Penis agenesis	Penis Agenesis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Plexiform Neurofibroma	Plexiform neurofibroma	CTD_human_DG	25551830		★★★★★ ★☆☆☆☆ Found in Text Mining only
Posterior synechiae	Synechiae	BEFREE	30004959		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	30205301		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary physiologic amenorrhea	Physiologic Amenorrhea	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	10403904, 15492251, 15605394, 22410775, 28455956, 30291220, 31269290		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	22410775, 22516347, 26036314	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	32915645	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	14565870, 22806541, 26364599, 28289089, 28492542, 28986088, 29309249, 31184937, 31501521, 31585940		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	22461510, 26573603, 28377632, 36153506, 38369783	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	25528764	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcopenia	Sarcopenia	Pubtator	40660573	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Schwannomatosis, Plexiform	Schwannomatosis	CTD_human_DG	25551830		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	26798410	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin Neoplasms	LHGDN	16641895		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	28698200		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	21731696, 35022314	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	16641895, 25873175, 28118606		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	29434888, 31781483		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	27671334	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	28025482, 29792310	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	25136066, 25767293, 29792310, 30093568		★★★★★ ★☆☆☆☆ Found in Text Mining only
ST segment elevation myocardial infarction	ST Segment Elevation Myocardial Infarction	BEFREE	29119801		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	12168903, 28454330		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	39357518	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Strabismus	Strabismus	BEFREE	28237412		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	22907951	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	36203174	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	23629654, 37373171	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	23921085, 25482942, 27357025, 27923843, 28422142, 29097911, 29935762, 30289981, 31007848, 31844158		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	23921085, 25482942, 26759246, 30386383, 36042208, 38172210	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	27671334, 28422142	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Tubular Aggregate Myopathy	Tubular Aggregate Myopathy	BEFREE	28251492		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	26225770, 32802870, 33830879, 34286546, 37313656	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	28720772	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	24572151, 26924277	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	31181097		★★★★★ ★☆☆☆☆ Found in Text Mining only

AXL (AXL receptor tyrosine kinase)